GapMind for catabolism of small carbon sources

 

Protein GFF2270 in Pseudomonas simiae WCS417

Annotation: FitnessBrowser__WCS417:GFF2270

Length: 342 amino acids

Source: WCS417 in FitnessBrowser

Candidate for 37 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 43% 99% 261.9 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 43% 95% 258.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 42% 95% 256.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 84% 251.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 84% 251.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
trehalose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 92% 251.1 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 40% 92% 247.3 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 42% 78% 242.7 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism malK med ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 42% 90% 241.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 43% 82% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 43% 78% 232.3 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 43% 78% 229.9 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 43% 81% 229.9 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 77% 229.6 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 94% 245.4 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 94% 245.4 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 94% 245.4 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 40% 91% 236.9 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 95% 236.9 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 39% 95% 236.5 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 44% 67% 228.8 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 93% 225.7 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 93% 225.7 Fe(3+) ions import ATP-binding protein FbpC, component of Hexose-phosphate transporter 46% 267.3

Sequence Analysis Tools

View GFF2270 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAFLQLNALSKRYGAVDAVVATDLAVEKGEFVSLLGPSGCGKTTTLQMIAGFVDVSGGQI
LLDGRDITHAKPASRGLGVVFQSYALFPHMSVRDNVAFGLKMRKVPAAEIASKVKTVLEL
VRLAPHADRYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDANLREEMQFEIRRIQ
CAVGITTLMVTHDQAEALSISDRVVVMQAGRVTQIDAPYKLYEHPRTRFISDFVGKANLL
PGDYDLLGSPQVRHESGDGELTLSLRPEKIQLVDAGSGRLQGKVLDSYFFGSQWLYRIHT
SLGEITVVRSNDGSAPLGYGAAVGLDWQASLLRVLAKDEVHA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory