GapMind for catabolism of small carbon sources

 

Protein GFF2490 in Pseudomonas simiae WCS417

Annotation: PS417_12700 ABC transporter ATP-binding protein

Length: 367 amino acids

Source: WCS417 in FitnessBrowser

Candidate for 48 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK hi ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 100% 100% 715.7 ABC transporter for Lactose, ATPase component 57% 393.7
D-sorbitol (glucitol) catabolism mtlK hi ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 100% 100% 715.7 ABC transporter for Lactose, ATPase component 57% 393.7
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 57% 99% 393.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 52% 99% 375.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 55% 94% 374.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 53% 100% 357.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 342.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism thuK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 342.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 342.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 342.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 51% 99% 337 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 50% 98% 335.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 50% 97% 335.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 48% 100% 325.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 51% 100% 325.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 51% 100% 325.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 95% 324.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 50% 96% 323.2 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 48% 98% 315.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 48% 98% 315.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 47% 93% 311.6 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 47% 93% 310.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 44% 99% 308.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 45% 98% 305.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 97% 304.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 50% 84% 303.5 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
xylitol catabolism HSERO_RS17020 med ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 46% 88% 303.1 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 46% 99% 298.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 46% 94% 295.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 96% 268.9 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 51% 73% 242.3 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 39% 80% 208.4 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 35% 99% 206.8 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 97% 205.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 97% 205.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 97% 205.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 34% 97% 205.7 ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component 100% 715.7

Sequence Analysis Tools

View GFF2490 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTI
ELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKKLVESKVSEAARI
LELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLH
KELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKMG
FLKGKVTRVESQSCEVQLDAGTLINLPLSGATLSVGSAVTLGIRPEHLEIASPGQTTLTV
TADVGERLGSDTFCHVITANGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFDTDGVAVA
RPLRAAA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory