Align BadK (characterized)
to candidate GFF2524 PS417_12870 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__WCS417:GFF2524 Length = 270 Score = 118 bits (296), Expect = 1e-31 Identities = 83/264 (31%), Positives = 130/264 (49%), Gaps = 18/264 (6%) Query: 7 LTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGAD 66 + E G V + +NRP+ +NA+N A + + D + A+V++G + F++G D Sbjct: 8 VVELIGNVAHVQINRPEKINAMNAAFWTEIIDIFQWIEDTDAVRAVVLSGAGKHFSSGID 67 Query: 67 IASMAAWSYSDVYGSNFITRNWETIRQ--------------IRKPVLAAVAGLAYGGGCE 112 + +A S ++ +G + + RN +R+ RKPVLAAV G GG + Sbjct: 68 LMMLA--SVANEFGKD-VGRNARLLRRKILELQASFNAVDNCRKPVLAAVQGYCIGGAID 124 Query: 113 LALACDIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEAD 172 L ACD+ A A+F++ EI +G+ G QRLPR IG ++ + R AEEA Sbjct: 125 LISACDMRYAAEGAQFSIKEIDIGMAADVGTLQRLPRIIGDGMLRELAYTGRQFGAEEAR 184 Query: 173 RYGLVSRVV-DDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERREL 231 GLV+RV D D L + +A IAA S A+ K ++ + T+ +G+ + Sbjct: 185 SIGLVNRVYPDQDSLLAGVMEIAHEIAAKSPIAVTGTKAMISYMRDHTVNDGLEYVATWN 244 Query: 232 HARFASADAREGIQAFLEKRAPCF 255 A S D R I A + K+ P F Sbjct: 245 AAMLQSNDLRVAIAAHMSKQKPEF 268 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 270 Length adjustment: 25 Effective length of query: 233 Effective length of database: 245 Effective search space: 57085 Effective search space used: 57085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory