Align FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate GFF2912 PS417_14900 C4-dicarboxylate ABC transporter permease
Query= TCDB::Q9RBQ9 (439 letters) >FitnessBrowser__WCS417:GFF2912 Length = 426 Score = 202 bits (515), Expect = 1e-56 Identities = 128/419 (30%), Positives = 218/419 (52%), Gaps = 10/419 (2%) Query: 16 VLLFLGLPVAYSFFAINVVGAWLFLGGDSALGQLVRNGLVAVASFSLTPIPLFILMGELL 75 V +FLG+P+A S V +F ++ L +++ IP F+L G + Sbjct: 12 VFMFLGVPIAISLGLSGAVSILMF--SQDSVSSLAIKLFETSDAYTFLAIPFFLLSGAFM 69 Query: 76 FHTGLAQRAIDGIDKVIPRLPGRLAVIAVVAGTFFSAISGSTIATTAMLGSLMLPMMLAR 135 G+AQR ID + + + G LA+ AV+A F+A+SGS+ AT A +GS+ + M+ Sbjct: 70 TTGGVAQRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAVAGMVRS 129 Query: 136 GYEPKLGMGPIIAIGGVDMLIPPSALAVLLGSLAGISISKLLIGGVLPGLLLAISFVAYI 195 GY G G I G + +LIPPS + V+ + S+ KL + GV+PGLLL + + I Sbjct: 130 GYPKAFGAGIICNAGTLGILIPPSIVMVVYSAATETSVGKLFMAGVIPGLLLGLMLMIAI 189 Query: 196 VASAKLRPESAPREELVVLRGWERWRELVVYVLPLSLIFVAIVAVISGGVATPTEAAAIG 255 A+++ P + R W + L L+ V I+ I G+ TPTEAAA+ Sbjct: 190 YIVARIK--KLPAQPRATFREWLTSARRAFWGL---LLLVIILGGIYSGMFTPTEAAAVA 244 Query: 256 CAATLAITL-MYRALRWQSLVQALQGTVAISGMILFIIVAATTFSQVLSFSGATNGIVDL 314 + + L +Y+ ++ + + L + ++ M++FII A F+ VL+ I Sbjct: 245 AVYSAFVALFIYKDMQLRDCPKVLLESGRLAIMLMFIIANAMLFAHVLTTEQIPQEITAW 304 Query: 315 VQSSGLPPAGVVAIMLAILIFLGLFVDQVSMMLLTLPFYMPIVKSLGIDQIWFGVMYLIC 374 V S GL P G + ++ +L+ G F++ +++L+ P + PI LGID I G++ ++ Sbjct: 305 VLSEGLTPIGFLIMVNVVLLIAGSFMEPSAIVLILAPIFFPIAMKLGIDPIHLGIVMVVN 364 Query: 375 MQLGLLMPPHGMLLYTMKGVAPKHITMGQVFASAMPYVGLSFTMLILIFFWPGIATWLP 433 M++GL+ PP G+ L+ V +T+GQ +A+P++ + LI++ + P I+ LP Sbjct: 365 MEIGLVHPPVGLNLFVTSAVT--GLTLGQTIRAALPWLMILLVFLIMVTYLPFISLALP 421 Lambda K H 0.329 0.143 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 426 Length adjustment: 32 Effective length of query: 407 Effective length of database: 394 Effective search space: 160358 Effective search space used: 160358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory