Align Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase; HMG aldolase; EC 4.1.3.17; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.1.112; Regulator of ribonuclease activity homolog; RraA-like protein (uncharacterized)
to candidate GFF3716 PS417_19020 dimethylmenaquinone methyltransferase
Query= curated2:Q9KBI9 (210 letters) >FitnessBrowser__WCS417:GFF3716 Length = 221 Score = 122 bits (307), Expect = 4e-33 Identities = 72/207 (34%), Positives = 112/207 (54%), Gaps = 10/207 (4%) Query: 4 AEIDFITQFRTIPTTCISDALD---GLTNLTSTIKPLNENDQVVGPARTVQVASGDNLAV 60 A + + F + T ISD L G LT N + ++VG A TV+ GDNL + Sbjct: 15 APAELVEAFAQVVTPHISDNLGRHIGARGLTR----YNRSGKLVGTAITVKTRPGDNLLI 70 Query: 61 LKAMYEASPGDVIVIDAKGDCTRAIAGDFVLGMAKTLGIAGFVVDGAIRDIRASKALNFP 120 KAM PG V+V+D +GD A+ G+ V A+ G GFV+DGAIRD+ + + P Sbjct: 71 YKAMSLLQPGHVLVVDGQGDTNNAVIGELVKLYAQQRGCVGFVIDGAIRDVASFD--DTP 128 Query: 121 IFCRGTTIAASKKTGIGNINVPISCGGVPIRPGDLIVGDADGVTVIPKGQEENVLQKAKK 180 + R KTG G +NVP+S GG+ + PGDL+VGD DG+ + VL++A + Sbjct: 129 CYARAVVHTGPYKTGPGEVNVPVSIGGMLVNPGDLVVGDEDGLVAFSQADAAEVLRRAAQ 188 Query: 181 KQADDEARERAISDNVMAIRAYLEKMI 207 +EA + I+ + +++++K++ Sbjct: 189 HAEHEEAVKAEIASGAVR-QSWIDKVL 214 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 221 Length adjustment: 22 Effective length of query: 188 Effective length of database: 199 Effective search space: 37412 Effective search space used: 37412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory