Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate GFF4142 PS417_21215 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::P76082 (255 letters) >FitnessBrowser__WCS417:GFF4142 Length = 715 Score = 111 bits (277), Expect = 5e-29 Identities = 69/181 (38%), Positives = 106/181 (58%), Gaps = 15/181 (8%) Query: 9 QQRVLLLTLNRPA-ARNALNNAL---LMQLVNELEAAATDTSISVCVITGNARFFAAGAD 64 Q +++LTL+ P + N +N A + +V LEA D ++ VIT + F AG D Sbjct: 11 QDGIVVLTLDMPGQSANTMNGAYREAMAAMVERLEAQKDD--LAGVVITSAKKTFFAGGD 68 Query: 65 LNEMAE------KDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVV 118 LNE+ + KD ++ + + QL RL+ KP++AA+NG ALG G E+ L C V Sbjct: 69 LNELIKVDKAHAKDFYDSVRELKAQL-RRLETLGKPVVAAINGAALGGGWEICLACHYRV 127 Query: 119 A--GENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSD 176 A ++ + GLPE+TLG++PG GG R++R +G A +L G+ + QQA QAGLV++ Sbjct: 128 ALDDKSVQLGLPEVTLGLLPGGGGVVRMVRMLGLEKALPYLLEGKKVRPQQALQAGLVNE 187 Query: 177 V 177 + Sbjct: 188 L 188 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 715 Length adjustment: 32 Effective length of query: 223 Effective length of database: 683 Effective search space: 152309 Effective search space used: 152309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory