Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2 (characterized, see rationale)
to candidate GFF1324 PS417_06730 3-carboxy-cis,cis-muconate cycloisomerase
Query= uniprot:A0A0C4YE08 (470 letters) >FitnessBrowser__WCS417:GFF1324 Length = 451 Score = 457 bits (1175), Expect = e-133 Identities = 240/447 (53%), Positives = 302/447 (67%), Gaps = 4/447 (0%) Query: 3 TSSRLTDPMFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAG 62 TS++L D F + + F D +Q MLD EA LARA+A GVIP A IA C A Sbjct: 5 TSNQLFDAYFTAGSMAEVFCDQGRLQGMLDVEAGLARAQAQVGVIPQAAVAPIAQACLAS 64 Query: 63 EIDFDALAAAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLRE 122 D DAL AA GN AIPLV+ L +A+ DA A RYVH GATSQD +DTG+VLQLR Sbjct: 65 LYDVDALGAAIATAGNSAIPLVKALGKLIASEDAGAERYVHLGATSQDVMDTGLVLQLRR 124 Query: 123 ALQAVDADLKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRL 182 A++ ++ADL LG AA A ++ D P+ RTWLQHA P T G+K AGWL A+ R+ +RL Sbjct: 125 AVELIEADLVRLGDRLAAQAQRYADVPLAGRTWLQHATPVTLGMKIAGWLGAVTRNRQRL 184 Query: 183 DAARAQAATLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTL 242 A + + LQFGGA+GTLA+LG A VA AL + L L++ PWH RDR+VE A+ L Sbjct: 185 TALKPRLLVLQFGGASGTLAALGEQAMPVAEALAAELQLSLPEQPWHTQRDRLVEFASVL 244 Query: 243 GMLTGSLGKIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPP 302 G++ GSLGK+ RD+SL+MQTE AEV EP+ PG+GGSSTMPHKRNPVG A +++AA RVP Sbjct: 245 GLIAGSLGKLGRDISLLMQTEAAEVFEPSAPGKGGSSTMPHKRNPVGAAVLISAATRVPG 304 Query: 303 LVATMLAGMVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLG 362 LV+TM + M QEHER+LG W AEW+TLP+I L +GAL Q L V GL+VD RM NL Sbjct: 305 LVSTMFSAMPQEHERSLGLWHAEWETLPEICRLVSGALHQALLVSEGLEVDPQRMAQNLD 364 Query: 363 VTHGLILAEAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLM 422 +THGL+LAEA + L ++GR AHHL+E C+RAVAEG LR A LA++ + Sbjct: 365 LTHGLVLAEAVSIVLAQRLGRETAHHLLEQCCKRAVAEGRHLR----AVLADEPQVTAEL 420 Query: 423 DAAALDRVCDPANYAGQAAGFVDAVLA 449 A LDR+ DPA+Y GQA +V +A Sbjct: 421 SAIELDRLLDPAHYLGQAHTWVTRAVA 447 Lambda K H 0.319 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 451 Length adjustment: 33 Effective length of query: 437 Effective length of database: 418 Effective search space: 182666 Effective search space used: 182666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate GFF1324 PS417_06730 (3-carboxy-cis,cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.8414.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-141 457.1 12.2 2e-141 456.8 12.2 1.1 1 lcl|FitnessBrowser__WCS417:GFF1324 PS417_06730 3-carboxy-cis,cis-mu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1324 PS417_06730 3-carboxy-cis,cis-muconate cycloisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.8 12.2 2e-141 2e-141 1 338 [] 9 352 .. 9 352 .. 0.98 Alignments for each domain: == domain 1 score: 456.8 bits; conditional E-value: 2e-141 TIGR02426 1 lldglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealaeaaaeagnvvi 75 l+d++f++ +ae+f d++rl++mldvEa laraqa+vG+ip++a++ ia a+ + +D+ al +a+a+agn++i lcl|FitnessBrowser__WCS417:GFF1324 9 LFDAYFTAGSMAEVFCDQGRLQGMLDVEAGLARAQAQVGVIPQAAVAPIAQACLASLYDVDALGAAIATAGNSAI 83 78999********************************************************************** PP TIGR02426 76 plvkalrkavae...eaaryvHlGaTSQDviDTalmLqlrdaldllladlerlaeaLaelaarhrdtpltarTll 147 plvkal k +a+ a+ryvHlGaTSQDv+DT+l+Lqlr+a++l++adl rl ++La++a+r +d pl +rT+l lcl|FitnessBrowser__WCS417:GFF1324 84 PLVKALGKLIASedaGAERYVHLGATSQDVMDTGLVLQLRRAVELIEADLVRLGDRLAAQAQRYADVPLAGRTWL 158 ***********9777789********************************************************* PP TIGR02426 148 QqAvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtlaalekkglavaealAaelgLeapalpWhtq 222 Q+A+p+t+g+k+agwl av+r+r+rl+al+ ++l+lqfGGA+Gtlaal+++++ vaealAael+L++p++pWhtq lcl|FitnessBrowser__WCS417:GFF1324 159 QHATPVTLGMKIAGWLGAVTRNRQRLTALKPRLLVLQFGGASGTLAALGEQAMPVAEALAAELQLSLPEQPWHTQ 233 *************************************************************************** PP TIGR02426 223 rdriaelaaaLalvagalgkiaqDvallaqtevgevle.agg..GGSSampHKrNPvaaevlaaaarrapglvat 294 rdr++e+a++L+l+ag+lgk+++D++ll+qte++ev+e +++ GGSS+mpHKrNPv+a+vl++aa+r+pglv+t lcl|FitnessBrowser__WCS417:GFF1324 234 RDRLVEFASVLGLIAGSLGKLGRDISLLMQTEAAEVFEpSAPgkGGSSTMPHKRNPVGAAVLISAATRVPGLVST 308 **************************************766689******************************* PP TIGR02426 295 LfaalaqedeRsaggWhaeWetLrelvaltagalrqaaellegl 338 +f+a++qe+eRs+g WhaeWetL+e+++l++gal+qa ++egl lcl|FitnessBrowser__WCS417:GFF1324 309 MFSAMPQEHERSLGLWHAEWETLPEICRLVSGALHQALLVSEGL 352 *************************************9999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (451 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.71 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory