GapMind for catabolism of small carbon sources

 

Aligments for a candidate for praB in Pseudomonas simiae WCS417

Align 2-aminomuconate semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate GFF4851 PS417_24810 aldehyde dehydrogenase

Query= metacyc::MONOMER-13349
         (490 letters)



>lcl|FitnessBrowser__WCS417:GFF4851 PS417_24810 aldehyde
           dehydrogenase
          Length = 506

 Score =  347 bits (890), Expect = e-100
 Identities = 192/491 (39%), Positives = 283/491 (57%), Gaps = 17/491 (3%)

Query: 3   QYRNYINGEWVE--SARRFDDVNPVDGTVVAQVHEADREAVDSAIRAGHAAVRGAWGRTT 60
           +Y NYI GE+V       F + +PV+G  +A+   +  + +D A+ A HAA   AWG+T+
Sbjct: 18  KYGNYIGGEFVAPVDGNYFTNTSPVNGKAIAEFPRSTAKDIDKALDAAHAAA-DAWGKTS 76

Query: 61  VAERAAILCRIADEIDRRYDDFLAAEIADTGKPVAMASTIDIPRGAANFRVFADILKTAP 120
             +RA +L +IAD I++  +     E  D GK V      DIP  A +FR FA  ++   
Sbjct: 77  AQDRALVLLKIADRIEQNLELLAITETWDNGKAVRETLNADIPLAADHFRYFAGCIRAQE 136

Query: 121 LDTFQTDLPDGARALNYAVRKPLGVVGVISPWNLPLLLLTWKIAPALACGNAVVAKPSEE 180
                T         +Y   +PLGVVG I PWN PLL+  WK+APALA GN VV KP+E+
Sbjct: 137 ----GTSAEINEHTASYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQ 192

Query: 181 TPGTATLLAEVMHTVGVPPGVFNLVHGFGPDSAGEFITTNDDIDAITFTGESRTGSAIMR 240
           TP    +L E++  + +PPGV N+VHG+G + AGE + T+  I  I FTG +  GS IM+
Sbjct: 193 TPLGINVLMELIGDL-LPPGVLNVVHGYGKE-AGEALATSKRIAKIAFTGSTPVGSHIMK 250

Query: 241 AAATHVKPVSFELGGKNAAIIFADCD------FEKMIDGMMRAVFLHSGQVCLCAERVYV 294
            AA ++ P + ELGGK+  I FAD         EK  +G++ A F + G+VC C  R  V
Sbjct: 251 CAAENIIPSTVELGGKSPNIFFADIMKAEPSFIEKAAEGLVLA-FFNQGEVCTCPSRALV 309

Query: 295 ERPIYNRFLDAFVERVKALKLGWPQDGTTGMGPLISAEHRDKVLSYFKLAREEGAQVLVG 354
           E  IY+ F+   +++V+ +K G P D  T +G   S +  DK+LSY ++A+ EGAQ+L G
Sbjct: 310 EESIYDDFMKVVMKKVEQIKRGDPLDTDTMVGAQASEQQFDKILSYLEIAKGEGAQLLTG 369

Query: 355 GGVPKFGDARDAGFWVEPTIITGLPQTARCIKEEVFGPICHVSPFDTEAEAIALANDTKY 414
           G V +       G++++PT++ G  +  R  +EE+FGP+  ++ F  EAEA+A+ANDT++
Sbjct: 370 GKVEQLSGDMAGGYYIQPTLLKGTNEM-RVFQEEIFGPVVSITTFKDEAEALAIANDTEF 428

Query: 415 GLSATTWTGNLNRGHRVSEAMRVGLSWVNSWFLRDLRTPFGGVGLSGIGREGGMHSLNFY 474
           GL A  WT ++NR +R+  A++ G  W N + L      FGG   SG+GRE     L+ Y
Sbjct: 429 GLGAGVWTRDINRAYRMGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHY 488

Query: 475 SELTNVCVRID 485
            +  N+ V  D
Sbjct: 489 QQTKNLLVSYD 499


Lambda     K      H
   0.321    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 591
Number of extensions: 21
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 490
Length of database: 506
Length adjustment: 34
Effective length of query: 456
Effective length of database: 472
Effective search space:   215232
Effective search space used:   215232
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory