Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate GFF1302 PS417_06615 leucine ABC transporter substrate-binding protein
Query= uniprot:G8ALJ3 (366 letters) >FitnessBrowser__WCS417:GFF1302 Length = 375 Score = 286 bits (733), Expect = 5e-82 Identities = 151/361 (41%), Positives = 216/361 (59%), Gaps = 3/361 (0%) Query: 4 KLSLLVAVAATAMTA--SVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGV 61 ++S L A A A S A I + AGP TG +G+ G +QA+ADINA GGV Sbjct: 7 QISKLFAAMVLAGVAGHSFAADTIKIGIAGPKTGPVTQYGDMQFMGAKQAIADINAKGGV 66 Query: 62 LGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISP 121 G+ L+ + DDACDPKQAVAVAN++ GVKFV GH CS S+ PAS +Y +EGV+ I+P Sbjct: 67 DGKMLEAKEYDDACDPKQAVAVANKVVNDGVKFVVGHLCSSSTQPASDIYEDEGVIMITP 126 Query: 122 ASTNPKLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQ 181 A+T+P++T + K +FR G D QG AG Y+ ++ K K VA+LHDK YG+G+A + Sbjct: 127 AATSPEITARGYKLIFRTIGLDSAQGPAAGNYIADHVKPKIVAVLHDKQQYGEGIATAVK 186 Query: 182 KALNAGGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLN 241 + L G K ++E AG+KD+S+++ KLKQ VD VY GGYH E GL+ RQ K++GLN Sbjct: 187 QTLEKKGTKVAVFEGLNAGDKDFSSIIQKLKQANVDFVYYGGYHPELGLILRQAKEKGLN 246 Query: 242 APIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEG-YTLY 300 A + + + + I A E ++T P K VE+F K +P G + Sbjct: 247 AKFMGPEGVGNDSISQIAQGASEGLLVTLPKSFDTDPANKAIVEEFAKNKQDPTGPFVFP 306 Query: 301 TYAALQIWAEAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNG 360 Y+A+++ A K A S D+AK+A+ + ++ T G + FDAKGD+ +V Y W+ G Sbjct: 307 AYSAIEVIAGGIKAAKSEDTAKVAEAIHAGTFKTPTGDLSFDAKGDLKDFKFVVYEWHFG 366 Query: 361 Q 361 + Sbjct: 367 K 367 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 375 Length adjustment: 30 Effective length of query: 336 Effective length of database: 345 Effective search space: 115920 Effective search space used: 115920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory