Align D-serine transporter DsdX (characterized)
to candidate GFF658 PS417_03340 gluconate transporter
Query= SwissProt::P08555 (445 letters) >FitnessBrowser__WCS417:GFF658 Length = 456 Score = 264 bits (675), Expect = 4e-75 Identities = 152/450 (33%), Positives = 246/450 (54%), Gaps = 10/450 (2%) Query: 1 MHSQIWVVST------LLISIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNA 54 + + +W+V +L++I I++ I K PFL++L+ +F G G+ P ++ A Sbjct: 3 LSTAVWMVHDTRLMFCVLLAIASIIVLISATKLPPFLSILIGTFIAGVGAGLPPEEVAKA 62 Query: 55 IESGIGGTLGFLAAVIGLGTILGKMMEVSGAAERIGLTLQRC-RWLSVDVIMVLVGLICG 113 G G LG +I LG++LG +M SGAA+RI TL + ++ +M LV ++ G Sbjct: 63 FSKGAGAILGEAGIIIALGSMLGALMAESGAADRIATTLLGLGKGKALPWVMALVAMVIG 122 Query: 114 ITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALYVANKLGA 173 + LF EVG+V+++P+ +AK++N LLK+AIP + +H ++PPHP L + L A Sbjct: 123 LPLFFEVGLVMMVPIILVMAKRSNQPLLKIAIPALAGMTTLHALMPPHPGPLIAVSALHA 182 Query: 174 DIGSVIVYGLLVGLMASLIGGPLFLKFLGQRLPFKPVPTEFADLKVRDEKT--LPSLGAT 231 D+G ++ G + + A ++ GP++ +L +RL P + L K PS + Sbjct: 183 DLGLTMLLGFCLAVPAVILAGPIYGNWLSKRLHVDE-PADIGALFSAPPKAPRQPSFTVS 241 Query: 232 LFTILLPIALMLVKTIAELNMARESGLYILVEFIGNPITAMFIAVFVAYYVLGIRQHMSM 291 L ILLP+ LML T+A++ + ES + + ++F+G P+ A+ +AV A LG M Sbjct: 242 LLIILLPVILMLGSTLAKVALPAESAIGLTLKFLGEPLIALGLAVVAAVICLGWAAGMPR 301 Query: 292 GTMLTHTENGFGSIANILLIIGAGGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVAL 351 + IA +LL IGAGG L + ++ T++ + HM +LLAWL+A+ Sbjct: 302 AEVGNTLRKALAPIAVLLLTIGAGGGLKQTLLDAGVSQTISKVAEGAHMPYLLLAWLIAV 361 Query: 352 ILHAAVGSATVAMMGATAIVAPMLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQY 411 L A GSATVA I+APM+ ++A+AIG+G++ V D+ FW+V++Y Sbjct: 362 ALRQATGSATVATTTTAGILAPMMAGLAAPQSSLVALAIGAGSVFFCHVNDAGFWMVREY 421 Query: 412 CGATLNETFKYYTTATFIASVVALAGTFLL 441 G L +T ++ I SVV L GT LL Sbjct: 422 FGLQLKQTIWVWSVLQTIVSVVGLVGTLLL 451 Lambda K H 0.329 0.143 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 36 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 456 Length adjustment: 33 Effective length of query: 412 Effective length of database: 423 Effective search space: 174276 Effective search space used: 174276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory