Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate GFF3396 PS417_17380 membrane protein
Query= SwissProt::Q9HU16 (427 letters) >FitnessBrowser__WCS417:GFF3396 Length = 426 Score = 331 bits (849), Expect = 2e-95 Identities = 180/424 (42%), Positives = 268/424 (63%), Gaps = 3/424 (0%) Query: 1 MTILFLFLLLFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIP 60 M L L L+ IG+P+A +LGLS AL + ++L I++ ++L+AIP Sbjct: 1 MDALILLGSFIALILIGMPVAYALGLS-ALIGAWWIDIPFQALMIQVAGGVNKFSLMAIP 59 Query: 61 FFLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGS 120 FF+L+GA M GG++RRL+ FA VG +RGGL++ ++A F A+SGSS A A+VGS Sbjct: 60 FFVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGS 119 Query: 121 IAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVY--AAATETSVGKLFIAGVVPG 178 + I M R GYP+ F + + +L PPS V+Y AA S+ LF+AGVVPG Sbjct: 120 VLIPEMERRGYPREFATAVTVSGSVQALLTPPSHNSVLYSLAAGGSVSIASLFMAGVVPG 179 Query: 179 LLLGLILMVVIYIVARVKKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPT 238 LL+ LMV+ I A+ + P + L++ L ALWGL+ MVIILGGI SG FT T Sbjct: 180 LLMSACLMVLCLIFAKKRNYPKGEVIPLKQALKICADALWGLMAMVIILGGILSGIFTAT 239 Query: 239 EAAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIP 298 E+AA+A +++ FV +F+YRD + SE PK++ + + ++M +IA A F +++T QIP Sbjct: 240 ESAAIAVLWAFFVTMFIYRDYKWSELPKLMHRTVRTISIVMILIAFAASFGYIMTLMQIP 299 Query: 299 QSIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLG 358 I + L + ++ L+ +N +LL+ G M+ + +ILIL PI P+ + +G+DP+H G Sbjct: 300 AKITTLFLTLSDNRYVILMCINAMLLLLGTVMDMAPLILILTPILLPVVLGIGVDPVHFG 359 Query: 359 IIMVVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSL 418 +IM+VN+ IGLITPPVG LFV +AV + + T++A LP+ +L + L+ VTYIPA+SL Sbjct: 360 MIMLVNLGIGLITPPVGAVLFVGAAVGKVSIEKTVKALLPFYGVLFLVLMAVTYIPALSL 419 Query: 419 ALPN 422 LP+ Sbjct: 420 WLPS 423 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 426 Length adjustment: 32 Effective length of query: 395 Effective length of database: 394 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory