Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate GFF2281 PS417_11630 sodium:dicarboxylate symporter
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__WCS417:GFF2281 Length = 434 Score = 387 bits (994), Expect = e-112 Identities = 203/418 (48%), Positives = 280/418 (66%), Gaps = 5/418 (1%) Query: 2 TTRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVS 61 T ++PLYK L FQVI A+ +GI G P+ K LGD F+KLIK +AP++F TVV Sbjct: 5 TAKKPLYKDLTFQVIAAMFLGIAFGFLAPELAAGFKILGDIFLKLIKTAVAPLVFFTVVH 64 Query: 62 GIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAA 121 GIA ++K VGK G AL+YFE+VSTIAL IGL+ N++Q G+GMH D A+ AA Sbjct: 65 GIASAGDIKRVGKVGLRALIYFEVVSTIALAIGLLWGNLLQIGSGMH-DAHPSSAAATAA 123 Query: 122 YVTAGKDQ---SIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVL- 177 K S + FI + P+ VGAFA G +LQVL+ SV+FGFAL L + V+ Sbjct: 124 SAAVAKGHAPASTLDFIYGIFPDNFVGAFAGGQLLQVLVISVLFGFALLALKPERREVIE 183 Query: 178 DFIDRFAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVL 237 D ++R + F IN+IMK AP+GA G++A+ +G+ G L+ L L++ FY+ F+ Sbjct: 184 DGLNRISECFFEFINLIMKFAPLGAFGSVAYAVGSNGTAVLMSLANLVLMFYVGIAFFIC 243 Query: 238 VVLGAICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIP 297 VVLGA+CR GFS+ + + YI++E+ IVLGT+SSESALPR+L K+E+ G K VGLV+P Sbjct: 244 VVLGAVCRLSGFSLWRFLTYIKDEIFIVLGTASSESALPRLLQKLEKFGCSKQSVGLVLP 303 Query: 298 TGYSFNLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLA 357 TGY+FNLDGTSIY+++ +FIA A + Q+ ++ ++L++SKGAA V+G F+V A Sbjct: 304 TGYAFNLDGTSIYMSLCVLFIANAYGVPLSWEQQLGIIAIMLVTSKGAAAVSGGSFVVFA 363 Query: 358 ATLSAVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAE 415 AT++A+G LP GLAL+ G+ RFMS A A N +GN+VATVVV+KW E + Q E Sbjct: 364 ATVTAIGVLPAEGLALLFGVYRFMSMAIATCNTIGNSVATVVVSKWSGEFSQQTAQDE 421 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 434 Length adjustment: 32 Effective length of query: 412 Effective length of database: 402 Effective search space: 165624 Effective search space used: 165624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory