Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate GFF2942 PS417_15055 C4-dicarboxylate ABC transporter
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__WCS417:GFF2942 Length = 436 Score = 397 bits (1021), Expect = e-115 Identities = 202/403 (50%), Positives = 288/403 (71%), Gaps = 5/403 (1%) Query: 9 KSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGMQN 68 +S++ QV++ + +GI+ G P+ LKPLGDGFIKLIKM+I I+FC VVSGI+G + Sbjct: 7 RSIFLQVVIGLMLGIICGLTLPEFSSQLKPLGDGFIKLIKMLIGLIVFCVVVSGISGAGD 66 Query: 69 MKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAGKD 128 +K VG+ G +++YFEI++T+AL+IGLV+ G G +I + L S A K Sbjct: 67 LKKVGRIGLKSVIYFEILTTVALVIGLVMAFSTGIGTGANIHLEQL--SSAGLNELADKG 124 Query: 129 QSIVG---FILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFAH 185 Q I G F++++IPN+++GAFA+ ++LQVL+FSV+FG AL+ +G + I+ +H Sbjct: 125 QHIRGTSQFLMDLIPNSVIGAFADNNVLQVLLFSVLFGSALNLVGEAASGISRLINELSH 184 Query: 186 VMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAICR 245 ++F I+ MI++LAPIG GA+AFT YG+ SL LG L+ FY+TC FV ++LG + R Sbjct: 185 IIFRIMGMIVRLAPIGVFGAIAFTTSTYGLDSLQHLGSLVGLFYLTCFAFVGLILGLVMR 244 Query: 246 AHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLD 305 G +L L++Y+REELLIV+GT+SS++ LP+++ K+E LG S VGLVIPTGYSFNLD Sbjct: 245 LSGLRMLPLLKYLREELLIVMGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYSFNLD 304 Query: 306 GTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGH 365 G SIYLT+A VFIA AT T + +T +T+LLV L++SKGA G+ GS ++LAATL+A+ Sbjct: 305 GFSIYLTLAIVFIANATGTPLSMTDLLTILLVSLITSKGAHGIPGSALVILAATLTAIPA 364 Query: 366 LPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELD 408 +PV GL L+L +D FM RALTNL+GN VATV +A+W K++D Sbjct: 365 IPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDID 407 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 436 Length adjustment: 32 Effective length of query: 412 Effective length of database: 404 Effective search space: 166448 Effective search space used: 166448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory