Align L-alanine and D-alanine permease (characterized)
to candidate GFF4632 PS417_23700 aromatic amino acid transporter
Query= reanno::pseudo5_N2C3_1:AO356_17670 (473 letters) >FitnessBrowser__WCS417:GFF4632 Length = 467 Score = 402 bits (1033), Expect = e-116 Identities = 198/446 (44%), Positives = 286/446 (64%), Gaps = 12/446 (2%) Query: 18 LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALGEMA 77 LKR L RHI+L+ALG IG GLFLGSA ++ AGP+++L Y I G +IMR LGEM Sbjct: 11 LKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEMI 70 Query: 78 VHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPDVPRWIW 137 V PVAGSFS +A Y G AGFL GWNYW L+++ +AE+TAV Y+ W+PD+P W+ Sbjct: 71 VEEPVAGSFSHFAHKYWGGYAGFLAGWNYWVLYVLVGMAELTAVGKYIQFWWPDIPTWVS 130 Query: 138 ALAALVSMGSINLIAVKAFGEFEFWFALIKIVTIIAMVIGGVGIIAFGFGNDGVALGISN 197 AL V++ IN + VK FGE EFWFA+IK+V I+ M++ G ++ G G G +SN Sbjct: 131 ALVFFVAVNLINTLNVKFFGETEFWFAIIKVVAIVGMIVLGCYLLFSGTG--GPQASVSN 188 Query: 198 LWAHGGFMPNGVSGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGSVFWRILLF 257 LW+HGGF PNG G+LMS+ +MF++ G+E++G+TA EA P+K IP AI V +RIL+F Sbjct: 189 LWSHGGFFPNGGMGLLMSMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQVVYRILIF 248 Query: 258 YVGALFVILSIYPWNEI---------GTQGSPFVMTFERLGIKTAAGIINFVVITAALSS 308 YVGAL V+LS+YPW+++ GSPFV F +G TAA I+NFVV+TAALS Sbjct: 249 YVGALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFSLIGNDTAAHILNFVVLTAALSV 308 Query: 309 CNGGIFSTGRMLYSLAQNGQAPAGFAKTSTNGVPRRALLLSIAALLLGVLLNYLVPEKVF 368 N G++ RML+ LA+ G AP K + GVP RAL +S +L V++NY+ P+ Sbjct: 309 YNSGVYCNSRMLFGLAEQGDAPKSLMKLNKQGVPIRALAISALVTMLCVVVNYVAPQSAL 368 Query: 369 VWVTSIATFGAIWTWVMILLAQLKFRKSLSASERAALKYRMWLYPVSSYLALAFLVLVVG 428 + ++ + W +I + +KFRK++ + ++ + +P S+YL LAF+V+++ Sbjct: 369 ELLFALVVASLMINWALISITHIKFRKAM-GEQGVTPSFKTFWFPFSNYLCLAFMVMIIS 427 Query: 429 LMAYFPDTRVALYVGPAFLVLLTVLF 454 +M P ++Y P ++ ++ V + Sbjct: 428 VMLAIPGISESVYAMPVWVGIIYVAY 453 Lambda K H 0.328 0.142 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 663 Number of extensions: 45 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 467 Length adjustment: 33 Effective length of query: 440 Effective length of database: 434 Effective search space: 190960 Effective search space used: 190960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory