Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate GFF3462 PS417_17725 ribose ABC transporter permease
Query= CharProtDB::CH_014278 (328 letters) >FitnessBrowser__WCS417:GFF3462 Length = 330 Score = 206 bits (525), Expect = 5e-58 Identities = 117/300 (39%), Positives = 178/300 (59%), Gaps = 8/300 (2%) Query: 26 GMLVVFAVLFIACAIFVPNFATFINMKGLGLAISMSGMVACGMLFCLASGDFDLSVASVI 85 G++VV V+ +A F+ T N+ + +S++ ++A GM + +G DLSV V+ Sbjct: 37 GLVVVTLVMILASDTFL----TASNLSNIARQVSINAIIAVGMTCVILTGGIDLSVGPVM 92 Query: 86 ACAGVTTA--VVINLTESLWIGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATMQIVR 143 A +G TA +V L L IG AG+L+GV G+ NG +A L + +I TLATM I R Sbjct: 93 ALSGTLTAGLMVAGLPPGLAIG--AGMLIGVAFGIGNGLFVAYLHMPPIIVTLATMGIAR 150 Query: 144 GLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRNTLAI 203 GL + +DG + + F G + FG+ PI + + ++ +LL T GR AI Sbjct: 151 GLGLMYTDGYPISGLPDWFAFFGRESLFGIQVPILIMLLTYLVAYVLLQHTRIGRYIYAI 210 Query: 204 GGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILASRMTSGQPMTSIGYELIVISACV 263 GGNEEA RL+GV R K++++ +SGL +AIAG++L SR+ SGQP + +EL I+A V Sbjct: 211 GGNEEAVRLSGVRAARFKLLVYGISGLTAAIAGLVLTSRLMSGQPNAGVSFELDAIAAVV 270 Query: 264 LGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISPFAQYVVRGLILLAAVIFDRYKQK 323 LGG S+ GG G I + G ++LG + N +N+L +SP+ Q V++G I+L A+ R + K Sbjct: 271 LGGASIAGGRGVIVGTLLGAMLLGVLNNGLNMLGVSPYVQSVIKGGIILLAIFISRQRHK 330 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 330 Length adjustment: 28 Effective length of query: 300 Effective length of database: 302 Effective search space: 90600 Effective search space used: 90600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory