GapMind for catabolism of small carbon sources

 

Aligments for a candidate for araH in Pseudomonas simiae WCS417

Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate GFF4163 PS417_21325 arabinose ABC transporter permease

Query= CharProtDB::CH_014278
         (328 letters)



>lcl|FitnessBrowser__WCS417:GFF4163 PS417_21325 arabinose ABC
           transporter permease
          Length = 321

 Score =  380 bits (977), Expect = e-110
 Identities = 200/323 (61%), Positives = 242/323 (74%), Gaps = 2/323 (0%)

Query: 1   MSSVSTSGSGAPKSSFSFGRIWDQYGMLVVFAVLFIACAIFVPNFATFINMKGLGLAISM 60
           MS V T+    P   F+  +  D + ML+    +F+  A+F+ NF + +NM+GLGLAIS 
Sbjct: 1   MSEVKTAKGFWP--GFNQRKFLDDWVMLLAALSIFVLSALFIDNFLSPLNMRGLGLAIST 58

Query: 61  SGMVACGMLFCLASGDFDLSVASVIACAGVTTAVVINLTESLWIGVAAGLLLGVLCGLVN 120
            G+ AC MLFCLASG FDLSV SVIACAGV   +VI  T+S+ +GV+A L +G++ GL+N
Sbjct: 59  VGIAACTMLFCLASGHFDLSVGSVIACAGVVAGIVIRDTDSVVLGVSAALAMGLVVGLIN 118

Query: 121 GFVIAKLKINALITTLATMQIVRGLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLT 180
           G VIAKL+INALI TLATMQIVRGLAYI S+GKAVG+ DE FF  G     G+P PI +T
Sbjct: 119 GIVIAKLRINALIATLATMQIVRGLAYIFSNGKAVGVMDEGFFVFGNGQLLGVPVPIIIT 178

Query: 181 VACLIIFGLLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILA 240
           V C + FG LLN TT+GRNT+AIGGN+EAA LAGV V RTKIIIF + GL+ A+AG+ILA
Sbjct: 179 VLCFVFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGLIGALAGVILA 238

Query: 241 SRMTSGQPMTSIGYELIVISACVLGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISP 300
           SRMTSGQPM   G+EL VISACVLGGVSL GGIG I +V+AG+LIL  +ENAMNL NI  
Sbjct: 239 SRMTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDT 298

Query: 301 FAQYVVRGLILLAAVIFDRYKQK 323
           F QYV+RG ILL AVI DR KQ+
Sbjct: 299 FYQYVIRGSILLLAVIIDRMKQR 321


Lambda     K      H
   0.327    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 418
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 328
Length of database: 321
Length adjustment: 28
Effective length of query: 300
Effective length of database: 293
Effective search space:    87900
Effective search space used:    87900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory