Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate GFF5220 PS417_26730 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >FitnessBrowser__WCS417:GFF5220 Length = 272 Score = 373 bits (958), Expect = e-108 Identities = 193/273 (70%), Positives = 231/273 (84%), Gaps = 1/273 (0%) Query: 1 MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA 60 MS RIAFIGAGNMAASLIGGLRA+G+ AAQIRASDPGA+ RA++ E I+ NAEA Sbjct: 1 MSNTRIAFIGAGNMAASLIGGLRAKGLDAAQIRASDPGADTRARVNTEHGIETFADNAEA 60 Query: 61 VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP 120 + DV+VL+VKPQAMKAVC++L P+L+P QL+VSIAAGI CAS+ WLG +P+VRCMP Sbjct: 61 IQGVDVIVLAVKPQAMKAVCESLRPSLQPHQLVVSIAAGITCASMNTWLGA-QPIVRCMP 119 Query: 121 NTPALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF 180 NTPAL+ QG SGLYA A+V+A Q +QA +LLSAVGIALWL+ E Q+DAVTAVSGSGPAYF Sbjct: 120 NTPALVSQGVSGLYATAEVTAEQRDQAHELLSAVGIALWLEQEQQLDAVTAVSGSGPAYF 179 Query: 181 FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA 240 FLL++AMT AG KLGLS++ A +L QTALGAA MA++S+V+ AELRRRVTSP GTT+AA Sbjct: 180 FLLIEAMTAAGVKLGLSKDVAEQLAEQTALGAAHMAVASDVDAAELRRRVTSPGGTTQAA 239 Query: 241 IKSFQANGFEALVEQALNAASQRSAELAEQLGQ 273 I+SFQA GFEALVE+AL AA+ RSAELAEQLG+ Sbjct: 240 IESFQAGGFEALVEKALGAAAHRSAELAEQLGK 272 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 272 Length adjustment: 25 Effective length of query: 248 Effective length of database: 247 Effective search space: 61256 Effective search space used: 61256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate GFF5220 PS417_26730 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.13406.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-83 265.8 8.5 2.6e-83 265.6 8.5 1.0 1 lcl|FitnessBrowser__WCS417:GFF5220 PS417_26730 pyrroline-5-carboxyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF5220 PS417_26730 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 265.6 8.5 2.6e-83 2.6e-83 1 263 [] 6 266 .. 6 266 .. 0.98 Alignments for each domain: == domain 1 score: 265.6 bits; conditional E-value: 2.6e-83 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPqdleev 75 ia+iGaGnm+++l+ gl +kg +++i ++ ++ +a+ +e g+e+ +d++ea++ dv++lavKPq +++v lcl|FitnessBrowser__WCS417:GFF5220 6 IAFIGAGNMAASLIGGLRAKGLD-AAQIRASDPGADTRARVNTEHGIETFADNAEAIQGVDVIVLAVKPQAMKAV 79 89**************9999765.8************************************************** PP TIGR00112 76 laelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellka 150 +++l+ + + ++l++Si+AG+t++ ++++l+a +++vR+mPNt+a v +gv++++a++ev++eq+++++ell+a lcl|FitnessBrowser__WCS417:GFF5220 80 CESLRP-SLQPHQLVVSIAAGITCASMNTWLGA-QPIVRCMPNTPALVSQGVSGLYATAEVTAEQRDQAHELLSA 152 *****9.7779********************86.99*************************************** PP TIGR00112 151 vGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkd 224 vG ++++e e++ldavta+sGSgPA++flliea+ +agvklGL+++ a++la qt Gaa++ s+ ++a+L+ lcl|FitnessBrowser__WCS417:GFF5220 153 VGIALWLEqEQQLDAVTAVSGSGPAYFFLLIEAMTAAGVKLGLSKDVAEQLAEQTALGAAHMAVASDVDAAELRR 227 *************************************************************************** PP TIGR00112 225 kVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 +VtsPgGtT+a++++++++g+++ v++a+ aa++rs eL lcl|FitnessBrowser__WCS417:GFF5220 228 RVTSPGGTTQAAIESFQAGGFEALVEKALGAAAHRSAEL 266 ************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory