Align ABC transporter for L-Arginine, periplasmic substrate-binding component (characterized)
to candidate GFF3436 PS417_17590 ABC transporter substrate-binding protein
Query= reanno::BFirm:BPHYT_RS07735 (264 letters) >FitnessBrowser__WCS417:GFF3436 Length = 258 Score = 228 bits (582), Expect = 7e-65 Identities = 119/247 (48%), Positives = 158/247 (63%), Gaps = 3/247 (1%) Query: 12 ALFAAASAT-AGTAAAADIKEVHFGVEASYAPFESKSPSGELQGFDIDVGNAVCAKLKAK 70 +LFAA TA A + KE+ FGV Y PFES + G LQGFDI++GNA+CAKL+ K Sbjct: 6 SLFAALLLPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEVK 65 Query: 71 CVWVENSFDGLIPALQARKFNAINSDMTITDQRRQAVDFTDPIYTIPNQMIAKKGSGLLP 130 C WV N FDG+IPAL+ARKF+AI S M +T R + +DF+D ++ P +I +K + Sbjct: 66 CTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFGD 125 Query: 131 TPASLKGKHVGVLQGTIQETYAKARWAPAGVDVVPYQTQDQIYADLASGRLDAAFQDAEA 190 TP SL GK VGVLQG++QE YA+A A G + YQ+QDQ YADL +GRLDA D Sbjct: 126 TPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKLE 185 Query: 191 ASKGFLKKPQGAGFEFAGPAVTDEKLLGAGVGFGVRKGDKALKDALNQALKELKADGTID 250 A FL KP+G+ F+ GPA D L + G+RK D+AL+ +N+ + ++ADGT Sbjct: 186 AQLNFLSKPEGSDFK-TGPAFKD-PTLPLDIAMGLRKNDQALRALINKGIAAVQADGTYA 243 Query: 251 RFAAKYF 257 + KYF Sbjct: 244 QIQKKYF 250 Lambda K H 0.317 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 258 Length adjustment: 25 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory