Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate GFF5420 PS417_27745 aldehyde dehydrogenase
Query= BRENDA::P76217 (492 letters) >FitnessBrowser__WCS417:GFF5420 Length = 497 Score = 194 bits (493), Expect = 6e-54 Identities = 145/466 (31%), Positives = 230/466 (49%), Gaps = 12/466 (2%) Query: 4 WINGDWITGQGASRVKR-NPVSGEVLWQGNDADAAQVEQACRAARAAFPR--WARLSFAE 60 +ING++ + +PV G +L DAA ++A ARA F W+RL+ A+ Sbjct: 23 YINGEYTAAVSGDTFECISPVDGRLLATVASCDAADAQRAVENARATFNSGVWSRLAPAK 82 Query: 61 RHAVVERFAALLESNKAELTAIIARETGKPRWEAAT-EVTAMINKIAISIKAYHVRTGEQ 119 R + + RFAALL++N EL + + GKP ++ +V N ++ S +A E Sbjct: 83 RKSAMLRFAALLKANAEELALLETLDMGKPISDSLNIDVPGAANALSWSGEAIDKIYDEV 142 Query: 120 RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEA 179 + D + P GV+ P+NFP + + PAL GN++I KPSE +P + Sbjct: 143 AATPHDQLGLVTREPVGVVGAIVPWNFPLMMACWKLGPALSTGNSVILKPSEKSPLTAIR 202 Query: 180 VMRLWQQAGLPPGVLNLVQG-GRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEK 238 + L +AG+P GV N++ G G G AL+ D+D L+FTGS QL + K Sbjct: 203 IAALAVEAGIPKGVFNVLPGYGHTVGNALALHMDVDTLVFTGSTKIAKQLLIRSGESNMK 262 Query: 239 ILALEMGGNNP-LIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLAR 297 + LE GG +P ++ + D+ AA + G+ CT RLL++ + D FL Sbjct: 263 RVWLEAGGKSPNIVFADAPDLQAAAESAAGAIAFNQGEVCTAGSRLLVERSIK-DKFLPL 321 Query: 298 LVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPR--LLQAGT 355 ++ + PGN D P +G L+ Q V++ + A G + + + L + G Sbjct: 322 VIEALKGWKPGNPLD-PATNVGALVDTQQMNTVLSYIEAGHADGAKLVAGGKRTLEETGG 380 Query: 356 SLLTPGIIE-MTGVAGVPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREK 414 + + P I + +T + EE+FGP+L V +D+ +EA+ +AN+T +GL+ + + + K Sbjct: 381 TYVEPTIFDGVTNAMKIAKEEIFGPVLSVITFDSAEEAVAIANDTIYGLAAAVWTADISK 440 Query: 415 FDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAAD 460 RAG V W G TAPFGG SGN R + +A D Sbjct: 441 AHLTAKALRAGSV-WVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFD 485 Lambda K H 0.318 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 642 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 497 Length adjustment: 34 Effective length of query: 458 Effective length of database: 463 Effective search space: 212054 Effective search space used: 212054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory