Align Succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate GFF4232 PS417_21680 succinylglutamate desuccinylase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1977 (336 letters) >FitnessBrowser__WCS417:GFF4232 Length = 334 Score = 539 bits (1388), Expect = e-158 Identities = 266/336 (79%), Positives = 306/336 (91%), Gaps = 2/336 (0%) Query: 1 MLALGKLLELTLAGREPAEKTQLTVEGVRMRWLSEGALEVRPPEARDNGLDLLLSAGIHG 60 MLALGKLLELTLAGREPA+K QLTV+GV+MRWLSEGALEVRPPEA+DNG DLLLS+GIHG Sbjct: 1 MLALGKLLELTLAGREPAQKIQLTVDGVQMRWLSEGALEVRPPEAKDNGSDLLLSSGIHG 60 Query: 61 NETAPIELLDRLLHDIARGDLKPRARILFLFGNPEAIRKGERFVEQDVNRLFNGRHEQSS 120 NETAPIELLDRLLH IARG++KPR RILFLFGNPEA+R+GER++E DVNRLFNGRHE++ Sbjct: 61 NETAPIELLDRLLHGIARGEIKPRTRILFLFGNPEAMRRGERYLELDVNRLFNGRHEKNI 120 Query: 121 GCEALRACELERLAASFFSLPDRQRLHYDLHTAIRGSKIEQFALYPWKEDRQHSRQELAR 180 G EA+RA ELE+LA SFFSLP R RLHYDLHTAIRGSKIEQFALYPWK+ RQHSR +LAR Sbjct: 121 GPEAMRAAELEQLARSFFSLPGRSRLHYDLHTAIRGSKIEQFALYPWKDGRQHSRHQLAR 180 Query: 181 LRAAGMEAVLLQNKPSIVFSSYTYDKLGAEAFTLELGKARPFGQNDGVNVSLLEKRLKQI 240 L AAGM+AVLLQNK SI F+++TY++L AEAFTLELGKARPFGQN GV+VS LE RLKQ+ Sbjct: 181 LNAAGMQAVLLQNKTSITFTAFTYEQLDAEAFTLELGKARPFGQNQGVDVSRLETRLKQL 240 Query: 241 IEGTEPELTEDALDGLQLYSVAREIIKHSDSFRLNLPADIENFSELEVGYLLAEDIANTR 300 IEGTEPE ++LDGLQL++V+RE+IKHSD+F ++LPAD+ENFS L GYLLAED+A TR Sbjct: 241 IEGTEPE--TESLDGLQLFAVSREVIKHSDAFLMHLPADVENFSPLAQGYLLAEDVAKTR 298 Query: 301 WIIEEEGARIIFPNPRVKNGLRAGILVVPTTDENLA 336 W+IEEEGARIIFPNP+VKNGLRAGIL+VPTT+ LA Sbjct: 299 WVIEEEGARIIFPNPKVKNGLRAGILIVPTTEAGLA 334 Lambda K H 0.319 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 334 Length adjustment: 28 Effective length of query: 308 Effective length of database: 306 Effective search space: 94248 Effective search space used: 94248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF4232 PS417_21680 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.1829946.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-122 394.8 0.0 1.7e-122 394.7 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF4232 PS417_21680 succinylglutamate de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF4232 PS417_21680 succinylglutamate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 394.7 0.0 1.7e-122 1.7e-122 1 319 [] 6 326 .. 6 326 .. 0.97 Alignments for each domain: == domain 1 score: 394.7 bits; conditional E-value: 1.7e-122 TIGR03242 1 dflaltlekkep.evtqgeaknvklrwldeGvlelePe..aeaekslvisaGihGnetaPielleqllsdiaagk 72 ++l+ltl+ +ep ++ q + +v++rwl eG+le++P ++ +l++s+GihGnetaPiell++ll+ ia+g+ lcl|FitnessBrowser__WCS417:GFF4232 6 KLLELTLAGREPaQKIQLTVDGVQMRWLSEGALEVRPPeaKDNGSDLLLSSGIHGNETAPIELLDRLLHGIARGE 80 589******9997889999*****************9866778899***************************** PP TIGR03242 73 lqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeLeqvveaffeagkasearyhyDlht 147 ++ ++r+L+++Gnp a+r+g+Ryle d+nRlf+Gr+ e + + e++Ra+eLeq ++ ff+ +++s r+hyDlht lcl|FitnessBrowser__WCS417:GFF4232 81 IKPRTRILFLFGNPEAMRRGERYLELDVNRLFNGRH-EKNIGPEAMRAAELEQLARSFFSLPGRS--RLHYDLHT 152 ************************************.7799***********************9..8******* PP TIGR03242 148 aiRasklekfallPyq.ekpfdkellewlaaadldavllhkekggtfshfssekleaeactlelGkarPfGendl 221 aiR+sk+e+fal+P + ++++++++l++l+aa+++avll++++++tf++f++e+l+aea+tlelGkarPfG+n+ lcl|FitnessBrowser__WCS417:GFF4232 153 AIRGSKIEQFALYPWKdGRQHSRHQLARLNAAGMQAVLLQNKTSITFTAFTYEQLDAEAFTLELGKARPFGQNQG 227 ****************99********************************************************* PP TIGR03242 222 sqfqaitealralisdeaiparkkeelklfevvesilkksdsfelhvaedasnftefakGtllaedkde.ryrve 295 + ++ ++++l++li +++ +++ + l+lf v ++++k+sd+f +h+++d++nf+++a+G+llaed ++ r+++e lcl|FitnessBrowser__WCS417:GFF4232 228 VDVSRLETRLKQLIEGTEPETESLDGLQLFAVSREVIKHSDAFLMHLPADVENFSPLAQGYLLAEDVAKtRWVIE 302 **************88777778888*****************************************9887***** PP TIGR03242 296 eeeerilfPnakvanGlRaglllv 319 ee++ri+fPn+kv+nGlRag+l+v lcl|FitnessBrowser__WCS417:GFF4232 303 EEGARIIFPNPKVKNGLRAGILIV 326 *********************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (334 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.75 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory