Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate GFF3809 PS417_19505 2,4-diaminobutyrate 4-aminotransferase
Query= SwissProt::P50457 (421 letters) >FitnessBrowser__WCS417:GFF3809 Length = 464 Score = 211 bits (536), Expect = 5e-59 Identities = 146/433 (33%), Positives = 222/433 (51%), Gaps = 23/433 (5%) Query: 8 QRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQ 67 QR+ + R + A+ ++DVEG +ID AG L GH HP ++ A++Q Sbjct: 29 QRQQESNARSYPRRIPLALKRAKGLYVEDVEGRRFIDCLAGAGTLALGHNHPVVIEAIQQ 88 Query: 68 QLQQFT--HTAYQIVPYESYVTLAEKINALAP-VSGQAKTAFF-TTGAEAVENAVKIARA 123 L HT P + + + L P ++ +AK F TG +AVE A+K+ R Sbjct: 89 VLADELPLHTLDLTTPVKDQF-VQDLFGLLPPALAREAKIQFCGPTGTDAVEAALKLVRT 147 Query: 124 HTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLH---GISTQ 180 TGR V++F GG+HG + ++L G + P K V +PYP D G+ Sbjct: 148 ATGRSTVLSFQGGYHGMSQGALSLMGSLGPKKPLGALLGNGVQFLPYPYDYRCPFGLGGA 207 Query: 181 D----SLDAIERLFKSDIEAKQV--AAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIV 234 + +L ++ L +D EA + AA+I E VQGEGG A + + +RR+ ++ G+ Sbjct: 208 EGVRVNLHYLDNLL-NDPEAGVLLPAAVIVEVVQGEGGVIPADLDWLRGLRRITEQAGVA 266 Query: 235 MIADEVQSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLG 294 +I DE+QSGF RTGKLFA +H PD++ M+K++ G +PL+ VV + +D PG Sbjct: 267 LIVDEIQSGFGRTGKLFAFEHAGIIPDVVVMSKAIGGSLPLA-VVVYRDWLDTWLPGAHA 325 Query: 295 GTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMI 354 GT+ GN +A+AA AV+ + L A +G+RL L + P + +RG G M+ Sbjct: 326 GTFRGNQMAMAAGSAVMRYLKDHDLAGHAAAMGERLGEHLRILQRDFPHLGDIRGRGLML 385 Query: 355 AVEFNDPQ-----TGEPSA--AIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQ 407 VE DP G P +A +Q+ L +GL+L G +G+V+RFL PL I + Sbjct: 386 GVELVDPNGTLDVQGHPPVHRQLAPLVQRECLKRGLILELGGRHGSVVRFLPPLVITAVE 445 Query: 408 FDAAMKILQDALS 420 D I AL+ Sbjct: 446 VDLVADIFGRALA 458 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 464 Length adjustment: 32 Effective length of query: 389 Effective length of database: 432 Effective search space: 168048 Effective search space used: 168048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory