Align Putative 4-guanidinobutyryl amide hydrolase (characterized, see rationale)
to candidate GFF2084 PS417_10630 hydratase
Query= uniprot:A0A291T3M3 (267 letters) >FitnessBrowser__WCS417:GFF2084 Length = 295 Score = 102 bits (255), Expect = 7e-27 Identities = 81/269 (30%), Positives = 122/269 (45%), Gaps = 21/269 (7%) Query: 17 ANLHELDAACRRARAEGAELLVTTELFITGYDIGDTVRDLARTDLLTPARQM------AA 70 +NLH+ A A GA L+V EL GY +L+ + A Sbjct: 26 SNLHQSLALATEAANGGANLIVLPELTNCGYFFSSRQDAFDHAELIPGGESVRAWIDFAC 85 Query: 71 SHGIALVLGAPEYDSGAYYNSAFFIDPAGTVLGRHRKNHLFGELDRRYFTPGDRTAPVID 130 H + LV G E D +N+A + P G + G++RK HL+ L++ +FTPGD PV + Sbjct: 86 KHQVYLVTGLCEIDGMQLFNTAVLLGPDGFI-GKYRKAHLWN-LEKLWFTPGDTGFPVFE 143 Query: 131 YGGVRIAMLICYDVEFPENVRAAALAGADLV--------AVPTAQMRPYEFIAEHLLRVR 182 RI +LIC+D+ FPE R + GAD++ P + +A +L Sbjct: 144 TPIGRIGLLICWDIWFPEVPRILSQQGADIICSLNNWVWTPPPLFDEAGKCMASYLTMTA 203 Query: 183 AWENQIYIAYVNHDGDEGSQRYVGRSSIVSPSATVLDSVEHGNR--LLFATVDPYTVREA 240 A N ++IA + G+E RY+G S I + + +V NR +LFA VD + R A Sbjct: 204 AHVNNVFIAAASRIGEEREARYLGCSLIAGTNGWPIGAVASANRQEILFADVDITSARSA 263 Query: 241 ---RKANPYLADLRPDLFTPSARATKDPS 266 N D R DL+ ++ P+ Sbjct: 264 PIWNSLNDLQRDRRIDLYDQMLGYSRHPA 292 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 295 Length adjustment: 26 Effective length of query: 241 Effective length of database: 269 Effective search space: 64829 Effective search space used: 64829 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory