Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate GFF4467 PS417_22865 CoA-transferase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__WCS417:GFF4467 Length = 397 Score = 211 bits (538), Expect = 2e-59 Identities = 142/407 (34%), Positives = 215/407 (52%), Gaps = 21/407 (5%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L+ L+V++L ++AGP+A +I A+ GA+VIKVE P GD R W + T Sbjct: 8 LAGLKVIELGTLIAGPFASRICAEFGAEVIKVESPDGGDPLRKWRKLY-------EGTSL 60 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 +++ A RNK+S+T++ P+G ++++L A +DILIENF+ G L GL +++L A+NP Sbjct: 61 WWFVQA-RNKKSLTLNLKHPDGLAILKQLLADADILIENFRPGVLEKLGLSWETLHALNP 119 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 +L+ ++GFGQTGP + G+ + + +GGL +T G E PV+ G+++ D + Sbjct: 120 KLVMVRLSGFGQTGPMKDQPGFGAVGESMGGLRYIT----GFEDRPPVRTGISIGDSIAA 175 Query: 184 LYSTAAILAALAHRDHVGG-GQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPNI 242 L++ L AL HR+ GG GQ +D+AL + A + + + G R GN P I Sbjct: 176 LWAVIGALMALRHREVNGGQGQVVDVALYEAIFAMMESMIPEFDVFGFI--RTGNIMPGI 233 Query: 243 VPYQDFPTADGDFI-LTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLIR 301 P +ADG + + D F++F G+ A+DP A+N R R L +I Sbjct: 234 TPSSIHTSADGKHVQIGANGDAIFKRFMLAIGREDLANDPELASNDGRDGRRDELYGVID 293 Query: 302 QATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARG--LAMELPHLLAGKVPQVA 359 + + + V QL QA VP I + DPQ AR L +LP K+P + Sbjct: 294 RWVNSLSLDQVVEQLNQAEVPASRIYSAEDMLGDPQFLAREMFLKAKLPGGKDFKMPGIV 353 Query: 360 SPIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFREAGVL 406 +LS+TP P LGEH VL LG DEAA+ RE G + Sbjct: 354 P--KLSDTPGSCEWVGPQLGEHN-NVLLNELGYDEAAITRLREQGAI 397 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 397 Length adjustment: 31 Effective length of query: 375 Effective length of database: 366 Effective search space: 137250 Effective search space used: 137250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory