GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Pseudomonas simiae WCS417

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate GFF3555 PS417_18205 aldehyde dehydrogenase

Query= BRENDA::Q9K9B2
         (515 letters)



>lcl|FitnessBrowser__WCS417:GFF3555 PS417_18205 aldehyde
           dehydrogenase
          Length = 492

 Score =  243 bits (620), Expect = 1e-68
 Identities = 152/444 (34%), Positives = 242/444 (54%), Gaps = 13/444 (2%)

Query: 51  KIQSWNPARKDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRR 110
           ++   NP   ++L+     +  DL + A Q+A  A   W  ++P +R+  L K A +I+ 
Sbjct: 29  RLDDRNPFNGERLLEMPLASVVDL-DDAYQAAQRAQTDWAALHPTQRSAQLEKLAQVIQD 87

Query: 111 RKHEFSAWLVHEAGKPWKEADADTAEAIDFLEYYARQMIELNRGKEILS-RPGEQNRYFY 169
           R  E   WL+ E+G    +A  +    ++ +   A   +++  G+ + S +PGEQ+  F 
Sbjct: 88  RSEEIIDWLIRESGSTRIKAGMEWQFTLNLVRECATLPMQVE-GRILSSYKPGEQSFVFR 146

Query: 170 TPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFV-EVLEDAGLPK 228
            P+GV   ISPWNF L + + + V  +  GNTVVLKPAS T V     +  + E+AG P 
Sbjct: 147 EPLGVVGVISPWNFPLYLSMRSVVPALALGNTVVLKPASDTAVTGGLLIAHLFEEAGFPA 206

Query: 229 GVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAAVVRPGQNHLKRVIVEMG 288
           G +N V G+G+E+GD  V+HP  SLI+FTGS DVG R   R A+   G  H+KRV +E+G
Sbjct: 207 GALNVVVGAGSEIGDAFVEHPIPSLISFTGSTDVG-RNVGRIAI---GGKHIKRVALELG 262

Query: 289 GKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLT 348
           G   +VV  DAD+++AA + +V  F   GQ C + +R ++ + +Y +     V    NL 
Sbjct: 263 GNAPLVVLDDADIEIAAHAAVVGRFLHQGQICMSVNRVIVDRSLYADFAALVVERVLNLK 322

Query: 349 VGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEG-RLMTGGEGDSSTGFFIQPTIIADLD 407
            GDP   D  +GPV+++   + ++  I+  ++ G + + GG+   + G  +   +  ++ 
Sbjct: 323 TGDPAKPDTVIGPVVNQSQLDGLLGKIDAAERAGLKQLCGGQ---AQGLVLPAHVFGEVG 379

Query: 408 PEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQAKREFHVGN 467
           PE  + ++E FGP++    A++  HALE+AN +EYGL+ AV TR+ A      R    G 
Sbjct: 380 PEQALARDETFGPLLPLMIAHNQAHALELANASEYGLSSAVFTRDMARGLSFARGIVAGM 439

Query: 468 LYFNRNCTGAIVGYHPFGGFKMSG 491
            + N + T       PFGG K SG
Sbjct: 440 THIN-DITVDDQPNAPFGGEKNSG 462


Lambda     K      H
   0.316    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 602
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 515
Length of database: 492
Length adjustment: 34
Effective length of query: 481
Effective length of database: 458
Effective search space:   220298
Effective search space used:   220298
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory