Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate GFF5498 PS417_28140 asparaginase
Query= reanno::pseudo3_N2E3:AO353_09960 (334 letters) >FitnessBrowser__WCS417:GFF5498 Length = 325 Score = 524 bits (1350), Expect = e-153 Identities = 265/326 (81%), Positives = 288/326 (88%), Gaps = 4/326 (1%) Query: 8 AAQHVMVLYTGGTIGMQASANGLAPASGFEARMRDYLHSQPDLVVPNWRFREMTPLIDSA 67 ++ +VMVLYTGGTIGMQAS +GLAPASGFEARMR+ L P P WRF+EM PLIDSA Sbjct: 3 SSSNVMVLYTGGTIGMQASTHGLAPASGFEARMREQLAHLP---APAWRFQEMAPLIDSA 59 Query: 68 NMTPAYWQRLRDAVIEAVDVDGCDSVLILHGTDTLAYSAAAMSFQLLGLHARVLFTGSML 127 NMTPAYWQRLR AV+EAVD DGCD+VLILHGTDTLAYSAAAMSFQLLGL A V+FTGSML Sbjct: 60 NMTPAYWQRLRTAVVEAVD-DGCDAVLILHGTDTLAYSAAAMSFQLLGLPAPVVFTGSML 118 Query: 128 PAGVPDSDAWENLGGALVALGQGLAPGVQLYFHGELLDPTRCAKIRSFGRHPFARLQRQG 187 PAGVPDSDAWEN+ GAL ALG+G+APGV LYFHG L+ PTRCAKIRSFGR+PFA L RQG Sbjct: 119 PAGVPDSDAWENVSGALAALGKGIAPGVHLYFHGALMAPTRCAKIRSFGRNPFAALNRQG 178 Query: 188 GGVKAPALPTALEYRQSKQLAKVGVLPLFPGIGAEQLDGVLNSGIQGLVLECFGSGTGPS 247 G +A ++P AL+YRQ K LA VGVLPL PGIGA QLD V+ SGIQ L+LECFGSGTGPS Sbjct: 179 GAARAESIPQALDYRQPKALASVGVLPLVPGIGAAQLDAVIGSGIQALILECFGSGTGPS 238 Query: 248 DNPEFLASLARARDQGVVVVAITQCHEGGVELDVYEAGSRLRGVGVLSGGGMTREAAFGK 307 DNPEFLASL RA+DQGVVVVAITQCHEGGVELDVYEAGSRLRGVGVLSGGGMTREAAFGK Sbjct: 239 DNPEFLASLQRAQDQGVVVVAITQCHEGGVELDVYEAGSRLRGVGVLSGGGMTREAAFGK 298 Query: 308 LHALLGADLDTAEVRRLVELDLCGEL 333 L+AL+GA LDT EVRRLVELDLCGEL Sbjct: 299 LNALIGAGLDTQEVRRLVELDLCGEL 324 Lambda K H 0.320 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 325 Length adjustment: 28 Effective length of query: 306 Effective length of database: 297 Effective search space: 90882 Effective search space used: 90882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory