Align ATPase (characterized, see rationale)
to candidate GFF969 PS417_04915 glutamine ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__WCS417:GFF969 Length = 254 Score = 304 bits (779), Expect = 1e-87 Identities = 155/245 (63%), Positives = 190/245 (77%), Gaps = 1/245 (0%) Query: 17 APETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQR 76 +PE +I +GV KWYG QF L ++L V++GE +V+ GPSGSGKST +R LN LE HQ+ Sbjct: 10 SPEGIIQMQGVNKWYG-QFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQ 68 Query: 77 GEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEA 136 G I ++G L++D + I IR+EVGMVFQ FNLFPHLT+LQN LAP+ VR+ P +AE Sbjct: 69 GRIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEE 128 Query: 137 TARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREV 196 A LERVRI EQA K+PGQLSGGQQQRVAIARAL M+P+I+LFDEPTSALDPEMV+EV Sbjct: 129 IAMHYLERVRIPEQAHKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEV 188 Query: 197 LDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQF 256 LD M LA +GMTML THE+GFAR VA+RV+ M G+IVE+A P+ FF PQ+DR K F Sbjct: 189 LDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQNDRTKLF 248 Query: 257 LAQIL 261 L+QIL Sbjct: 249 LSQIL 253 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 254 Length adjustment: 24 Effective length of query: 237 Effective length of database: 230 Effective search space: 54510 Effective search space used: 54510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory