Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate GFF217 PS417_01100 amino acid ABC transporter permease
Query= uniprot:A0A0H3PA28 (219 letters) >FitnessBrowser__WCS417:GFF217 Length = 221 Score = 94.7 bits (234), Expect = 1e-24 Identities = 64/196 (32%), Positives = 101/196 (51%), Gaps = 3/196 (1%) Query: 12 FLMQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLLWMLA 71 FL++G + T+ ++L ++ G LA+ + +L +LA Y+ FR TPLL+ + Sbjct: 14 FLLKGAYYTVILSLGGMFFGLLLGFGLALMRLSRFKLVSWLARVYVSFFRGTPLLVQLFL 73 Query: 72 ACFVLPVFFGQFPQAFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFEAAYSQGFGKFFTL 131 + LP + IGFSL ++ EI+R + SI +GQ+EAA S G + TL Sbjct: 74 IYYGLPQVGIELDPIPAAMIGFSLNMAAYACEILRAAIGSIERGQWEAAASIGMTRAQTL 133 Query: 132 FYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKLTSFEEILAMIG 191 ILPQ R +P L + ++ VKDTA A + + EL ++ + A+ EI M Sbjct: 134 RRAILPQAMRTALPPLGNSFISLVKDTALAATIQVPELFRQAQLVSARTF---EIFTMYL 190 Query: 192 VVAGIYFIICFSLSML 207 A IY+I+ L+ L Sbjct: 191 SAALIYWILASILAHL 206 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 221 Length adjustment: 22 Effective length of query: 197 Effective length of database: 199 Effective search space: 39203 Effective search space used: 39203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory