GapMind for catabolism of small carbon sources


Aligments for a candidate for acn in Pseudomonas simiae WCS417

Align aconitate hydratase (EC (characterized)
to candidate GFF2930 PS417_14990 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase

Query= BRENDA::P36683
         (865 letters)

>lcl|FitnessBrowser__WCS417:GFF2930 PS417_14990 bifunctional
           aconitate hydratase 2/2-methylisocitrate dehydratase
          Length = 869

 Score = 1375 bits (3560), Expect = 0.0
 Identities = 668/859 (77%), Positives = 759/859 (88%), Gaps = 3/859 (0%)















            D YRYLNF+Q++++ + A

Lambda     K      H
   0.317    0.136    0.400 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 2185
Number of extensions: 74
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 865
Length of database: 869
Length adjustment: 42
Effective length of query: 823
Effective length of database: 827
Effective search space:   680621
Effective search space used:   680621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

Align candidate GFF2930 PS417_14990 (bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase)
to HMM TIGR00117 (acnB: aconitate hydratase 2 (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00117.hmm
# target sequence database:        /tmp/gapView.22506.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00117  [M=844]
Accession:   TIGR00117
Description: acnB: aconitate hydratase 2
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
          0 1534.5   0.0          0 1534.3   0.0    1.0  1  lcl|FitnessBrowser__WCS417:GFF2930  PS417_14990 bifunctional aconita

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF2930  PS417_14990 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1534.3   0.0         0         0       1     843 [.       1     856 [.       1     857 [. 0.99

  Alignments for each domain:
  == domain 1  score: 1534.3 bits;  conditional E-value: 0
                           TIGR00117   1 lleeyrkhvaeraaegiaplplnakqvaalvellkndpeaeeefllellidrvppgvdeaayvkagflaaiakge 75 
                                         +le+yrkh+ eraa+gi p+plna+q+a lvellkn+p++eeefl++l+++r+ppgvdeaayvkagfl+a+akge
                                         79************************************************************************* PP

                           TIGR00117  76 vksplisaeeavellgtmlggynvepliealeskdkniakaaakalsktllvfdafddveelskt.neyakqvle 149
                                         ++spli  ++avellgtm+ggyn+ +l+e+l+  d+ +a++aa  l++tll+fdaf+dv+e+++  ne+ak v++
                                         ********************************..****************************9988********* PP

                           TIGR00117 150 swaeaewflnkeelaekitvtvfkvdgetntddlspapdaftrpdiplhalamlknkieeieq..........ri 214
                                         swa++ewf n+++la+ki+  vfkv+getntddlspapda++rpdiplhalamlk ++e+i +          +i
                                         *************************************************************99999********* PP

                           TIGR00117 215 kalkqkgvpvayvgdvvgtgssrksatnsvlwflgkdipfvpnkragglvlggkiapiffntaedsgalpievdv 289
                                         ++++ +g+p+ayvgdvvgtgssrksatnsvlwf+g+d+p+vpnkragg+++g kiapif+nt+ed+galpie dv
                                         *************************************************************************** PP

                           TIGR00117 290 kdlnegdvikiypykgeitnket.evvatfklkpetlldevraggripliigrgltdkarealglsesevfkkak 363
                                          ++n+gdvi++yp+ g++ ++ t ev++tf++k+ +lldevraggripliigrgltdkar  lgl+++++fk ++
                                         *********************9999************************************************** PP

                           TIGR00117 364 apaesakgftlaqklvgkacgv...kgirpgtycepkvttvgsqdttgamtrdelkelaslgfdadlvlqsfcht 435
                                         ap +++kgftlaqk+vgkacg+   kg+rpgtycepk+ttvgsqdttg+mtrdelk+la+lgf++dlv+qsfcht
                                         *********************87779************************************************* PP

                           TIGR00117 436 aaypkpvdvkthktlpdfisqrggvalrpgdgvihswlnrmllpdtvgtggdshtrfplgisfpagsglvafaaa 510
                                         aaypkp+dv th+tlpdfi++rggv+lrpgdg+ihswlnrmllpdtvgtggdshtrfp+gisfpagsglvafaaa
                                         *************************************************************************** PP

                           TIGR00117 511 tgvmpldmpesvlvrfkgelqpgitlrdlvnaipyyaikkglltvekkgkvnvfngrileieglpdlkveqafel 585
                                         tgvmpldmpes+lvrfkg+++pgitlrdlv+aipyyai+ glltvekkgk+n f+grileiegl dl +eqafel
                                         *************************************************************************** PP

                           TIGR00117 586 tdasaersaagctiklnkepvieylksnivllkemiaegyedkrtlkrridamekwlanpelleadadaeyaavi 660
                                         +dasaersaagctikl+ke++ eyl+sni ll++mi egy+d rtl+rr +ame+w++npel+eadadaeya++i
                                         *************************************************************************** PP

                           TIGR00117 661 eidlaeikepilaapndpddvkllsevagdaidevfigscmtnighfraagkileaak.tvkarlwvvpptrmde 734
                                         eidlaei+epil+apndpdd++lls vag++idevfigscmtnighfraagk+le+ k ++++rlw+ ppt+md+
                                         *******************************************************9988**************** PP

                           TIGR00117 735 qqlieegyyaifgaagartevpgcslcmgnqarvedgatvfststrnfdnrlgkgakvylgsaelaavaallgki 809
                                         +ql+eegyy+i+g+agar+e+pgcslcmgnqarve ++tv+ststrnf+nrlg ga+vyl+saelaava+ lg++
                                         *************************************************************************** PP

                           TIGR00117 810 ptkeeylalvsekvesakdklyrylnfnelenfe 843
                                         pt+eey+ + ++ +  a d +yrylnf+++ +f+
                                         *********9877766666.***********998 PP

Internal pipeline statistics summary:
Query model(s):                            1  (844 nodes)
Target sequences:                          1  (869 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.05
# Mc/sec: 13.37

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory