GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acn in Pseudomonas simiae WCS417

Align 2-methylcitrate dehydratase; 2-MC dehydratase; Aconitate hydratase; ACN; Aconitase; EC 4.2.1.79; EC 4.2.1.3 (characterized)
to candidate GFF4111 PS417_21060 2-methylcitrate dehydratase

Query= SwissProt::Q937N6
         (484 letters)



>lcl|FitnessBrowser__WCS417:GFF4111 PS417_21060 2-methylcitrate
           dehydratase
          Length = 494

 Score =  594 bits (1531), Expect = e-174
 Identities = 305/497 (61%), Positives = 366/497 (73%), Gaps = 16/497 (3%)

Query: 1   MSTDTPSAQRPDPDQVLVDIVDYVTRYEIKSGLAYDTARNCLIDTLGCGLEALSYPACTK 60
           MS +     RPD DQ+L DI DYV  Y I S  A DTARNCL+DTLGCGL AL +P CTK
Sbjct: 1   MSANVDQNNRPDYDQLLQDIADYVLNYRIDSRDALDTARNCLMDTLGCGLLALRFPECTK 60

Query: 61  LLGPVVPGTIVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGG 120
            LGP+V GT+VP GARVPGT F+LDPV+AA++IG ++RWLD+NDTWLAAEWGHPSDNLGG
Sbjct: 61  HLGPIVEGTVVPFGARVPGTSFRLDPVKAAWDIGCIVRWLDYNDTWLAAEWGHPSDNLGG 120

Query: 121 ILATADWISRNHIAAGRKPLTMKAVLAAMIKAHEIQGCIALENSFNQVGLDHVVLVKVAS 180
           ILA AD +S+  +A G  PLT++AVL AMI AHEIQG IALENSFN+VGLDHV+LVKVAS
Sbjct: 121 ILAVADHLSQKRVANGDVPLTVRAVLEAMIMAHEIQGVIALENSFNRVGLDHVLLVKVAS 180

Query: 181 TAVVAQMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNAGSRKSWAHGDATSRAVRLALIA 240
           TAV A+++G  R+++L A+S A+VDGQ+LRTYRHAPNAGSRKSWA GDA+SR VRLA IA
Sbjct: 181 TAVTAKLMGANREQLLAALSHAFVDGQALRTYRHAPNAGSRKSWAAGDASSRGVRLADIA 240

Query: 241 RTGEMGYPSVLTAKTWGFYDVLFK------------GQPFRFQRPYGTYVMENILLKISY 288
             GEMG P VL+A  WGFYDVLF              + F   +PYGTYVMEN+L KIS+
Sbjct: 241 MRGEMGIPGVLSAPQWGFYDVLFSHTNKDLALKPEDRRAFSLSQPYGTYVMENVLFKISF 300

Query: 289 PAEFHAQTAVEAAMQLHGALALAGRSAADIAAITIRTHEACLRIIDKLGPLSNPADRDHC 348
           PAEFHAQTA EAA+ LH           +I  I I THE+ +RII K+G L+N ADRDHC
Sbjct: 301 PAEFHAQTACEAAVTLH---PWVKDRLHEIDRIVITTHESAIRIISKVGQLANAADRDHC 357

Query: 349 IQYMVAVPLLFGRLTAADYEDRI-AADPRIDALRGRITCVEDPALTRDYHDPAKRSIANA 407
           +QYM AVPL FG L A  YED   AA P ID LR ++  VEDP  +R+Y +  KRSIANA
Sbjct: 358 LQYMTAVPLAFGNLVAEQYEDEFHAAHPIIDQLRDKMVIVEDPRYSREYLEADKRSIANA 417

Query: 408 LTVTLADGTVLDEVLVEYPLGHKRRRAEGIPLLVEKFRTNLARRFPPKQQQAILAASLDQ 467
           + V   DG+  ++V VEYP+GH+RRR EGIPLL +KF+ NLA RF  ++   I A   DQ
Sbjct: 418 VQVFFKDGSCTEQVAVEYPIGHRRRRVEGIPLLEDKFKANLATRFTGQRSAEIFALCKDQ 477

Query: 468 ARLEAMPVNEYLDMYAI 484
           ARLEA PVN ++D++ I
Sbjct: 478 ARLEATPVNRFVDLFVI 494


Lambda     K      H
   0.322    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 666
Number of extensions: 25
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 484
Length of database: 494
Length adjustment: 34
Effective length of query: 450
Effective length of database: 460
Effective search space:   207000
Effective search space used:   207000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory