Align Fe(3+) dicitrate-binding periplasmic protein; Iron(III) dicitrate-binding periplasmic protein (characterized)
to candidate GFF3535 PS417_18105 iron-dicitrate transporter substrate-binding subunit
Query= SwissProt::P15028 (300 letters) >FitnessBrowser__WCS417:GFF3535 Length = 306 Score = 273 bits (699), Expect = 3e-78 Identities = 143/294 (48%), Positives = 194/294 (65%), Gaps = 4/294 (1%) Query: 1 MLAFIRFLFAGLLLVISHAFAAT---VQDEHGTFTLEKTPQRIVVLELSFADALAAVDVI 57 ML I L A +L S +A + D L P+R+VVLE SF D+LAAVDV Sbjct: 3 MLRSIPTLAACVLAFSSSLLSAAPIDLNDGQHAVHLPDAPKRVVVLEFSFLDSLAAVDVT 62 Query: 58 PIGIADDNDAKRILPEVRAHLKPWQSVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIAL 117 P+G ADD DA R+LP VR + W+SVG R+QPS+E IA LKPDLI+AD +RH +Y L Sbjct: 63 PVGAADDGDANRVLPRVRQAIGQWKSVGLRSQPSIEEIARLKPDLIVADLNRHQALYSDL 122 Query: 118 QQIAPVLLLKSRNETYAENLQSAAIIGEMVGKKREMQARLEQHKERMAQWASQLPKGTRV 177 IAP LLL SR E Y +L+SA +IG+ +GK +M+AR+++++E + A Q+P G V Sbjct: 123 ASIAPTLLLPSRGEDYQGSLKSAELIGKALGKSAQMEARIQKNRENLNAIAQQIPAGASV 182 Query: 178 AFGTSREQQFNLHTQETWTGSVLASLGLNVPAAMAGASMPS-IGLEQLLAVNPAWLLVAH 236 FG +RE F++H +++ GSVL ++GL VP+ A A+ + LEQLLA++P WLLV H Sbjct: 183 LFGVAREDSFSVHGPDSYAGSVLEAIGLKVPSVRANAAPTEFVSLEQLLALDPGWLLVGH 242 Query: 237 YREESIVKRWQQDPLWQMLTAAQKQQVASVDSNTWARMRGIFAAERIAADTVKI 290 YR SIV W Q PLWQ+L A + +QVA VD ++WAR RG+ A+E+IA D + I Sbjct: 243 YRRPSIVDSWSQQPLWQVLGAVRNKQVAEVDGDSWARNRGVLASEQIAEDALAI 296 Lambda K H 0.320 0.131 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 306 Length adjustment: 27 Effective length of query: 273 Effective length of database: 279 Effective search space: 76167 Effective search space used: 76167 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory