Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate GFF3660 PS417_18730 ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__WCS417:GFF3660 Length = 334 Score = 172 bits (435), Expect = 1e-47 Identities = 104/279 (37%), Positives = 156/279 (55%), Gaps = 6/279 (2%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPS 105 V+ YRL R L+A GA LA GV++Q ++RNPLA P +LG++ AS +V L+ Sbjct: 53 VVWNYRLTRALVAAACGAGLATCGVILQSLLRNPLADPYLLGISAGASTGAVLVALIGVG 112 Query: 106 LPVMVLPLLAFAGGMAGLILLKMLAKTHQPM----KLALTGVALSACWASLTDYLML--S 159 ++ L AF G MA L+ +LA+ ++ L G+A S + +LT +L+ + Sbjct: 113 GGLISLSAGAFVGAMAAFALVILLARASGSASGTGQIILAGIAGSQLFNALTAFLITKSA 172 Query: 160 RPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGV 219 + L WL G+L G W V +A+P+ + L + L R LD G A +LG+ Sbjct: 173 SSEQARGILFWLLGNLSGVRWPSVWLAVPVAVAGLAVCLWHRRALDAFTFGSDSAASLGI 232 Query: 220 SVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALL 279 V +F + A +T+ V+ G I F+GLV+PH +R + G H RLLP SAL GAL Sbjct: 233 PVRRVQFVLVGCAALVTAVMVSIVGSIGFVGLVIPHAVRLLLGTGHSRLLPASALGGALF 292 Query: 280 LVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVRMR 318 L+ AD+L+R + +PVGV+TA++GAP F +L+ R Sbjct: 293 LIAADVLSRTLIKGQVIPVGVVTALVGAPVFALILIGRR 331 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 334 Length adjustment: 28 Effective length of query: 290 Effective length of database: 306 Effective search space: 88740 Effective search space used: 88740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory