Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate GFF1263 PS417_06415 ABC transporter substrate-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3431 (257 letters) >FitnessBrowser__WCS417:GFF1263 Length = 259 Score = 204 bits (519), Expect = 1e-57 Identities = 107/251 (42%), Positives = 158/251 (62%), Gaps = 5/251 (1%) Query: 2 KKLVLLGALALSVLSLPTFADE-KPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 K L+ L ALAL + + T A E K L+ G++ +Y PF SKA DGS+VGFD D+GNA+C E Sbjct: 3 KALLTLSALALCMAAGSTLAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAICAE 62 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPARLVMKAGT 120 +KVKC WVE +FDG+IP LK K D ++SSM++T R+K++DF+++ ++ P LV K G Sbjct: 63 LKVKCKWVESDFDGMIPGLKANKFDGVISSMTVTPVREKAIDFSSELFSGPTSLVFKKGA 122 Query: 121 AVSENLAELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 S LKGK++G ++G+I E +A+ VL G K Y +Q+++Y D+ +GRLD +V Sbjct: 123 GYS-TPESLKGKSVGYEQGTIQEAYAKAVLDKAGVTTKAYANQDQVYADLTSGRLDASVQ 181 Query: 181 DATLLDDGFLKTDAGKGFAFVGPAFTDVKYFGDGVGIAVRKGDA-LKDKINTAIAAIREN 239 D + GFLK+ AG G+ A D I ++KG+ LK ++ I A+ ++ Sbjct: 182 DMLQAELGFLKSPAGAGYEV--SAAIDDPLLPSKTAIGIKKGNTELKTLLDKGIKALHDD 239 Query: 240 GKYKQIQDKYF 250 G Y IQ K+F Sbjct: 240 GTYATIQKKHF 250 Lambda K H 0.318 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 259 Length adjustment: 24 Effective length of query: 233 Effective length of database: 235 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory