Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate GFF2137 PS417_10900 ABC transporter substrate-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__WCS417:GFF2137 Length = 258 Score = 171 bits (433), Expect = 1e-47 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 5/255 (1%) Query: 5 RSLFAALLLPLCATAHAQEW-KEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLE 63 RSL L L L A++HA K +R G+ YPPF S +G + GFD ++GNA+CA+++ Sbjct: 4 RSLITVLALGLLASSHAMAAEKTLRIGIEAAYPPFASKTEEGKIVGFDYDIGNALCAQMK 63 Query: 64 VKCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADF 123 VKC WV EFDG+IP+L+ +K D +SSM + R+K +DF+ + + + + ++ ++ A Sbjct: 64 VKCVWVEGEFDGLIPSLKVKKIDMALSSMTINEDRKKSVDFTHKYYFTSSRLVMKEGAVV 123 Query: 124 GDTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDK 183 D SL GK +GV + + + YA G +K Y + ++ Y DL GRLDA D Sbjct: 124 DDQYASLKGKTIGVQRATTTDRYATEVFEPKGINVKRYSNNEEIYMDLAAGRLDAIFADT 183 Query: 184 LEAQLNFLSKPEGSDFK-TGPAFKDPTLPLDIA-MGLRKNDQALRALINKGIAAVQADGT 241 + +FL P G + GP KDP + A + +RK + L +N I ++A G Sbjct: 184 IPLN-DFLQMPRGKGYAFVGPELKDPKYVGEGAGIAVRKGNTELVGQLNAAIDGIRASGE 242 Query: 242 YAQIQKKYFGDQDIY 256 Y +I ++YF DIY Sbjct: 243 YQKISQQYF-KSDIY 256 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory