Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate GFF2657 PS417_13545 arginine aminotransferase
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__WCS417:GFF2657 Length = 664 Score = 295 bits (754), Expect = 2e-84 Identities = 166/269 (61%), Positives = 203/269 (75%), Gaps = 8/269 (2%) Query: 8 LAAYPVDEPVAQPVTAAIKL-QVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKS 66 +AA P E V P A K+ +V +HKR+G EVLKG+SL A +GDVISLIGASGSGKS Sbjct: 395 IAAAPRIEEV--PAAEAKKMIEVIDLHKRFGNIEVLKGISLTAHEGDVISLIGASGSGKS 452 Query: 67 TMLRCINFLEQPDAGVITLDGISIEMRQGRAGTR-APHQDQLQNLRTRLAMVFQHFNLWS 125 T+LRCIN LE PD G I +DG SI++ GR G QL +R+ L MVFQ+FNLW Sbjct: 453 TLLRCINMLEVPDQGSIHVDGESIKLNYGRPGAPLVADARQLVRIRSTLGMVFQNFNLWP 512 Query: 126 HMTVLENITMAPRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIAR 185 H TVLEN+ AP +VL S AEA +RA L++VGL ++ ++YPAFLSGGQQQRVAIAR Sbjct: 513 HRTVLENLIEAPTQVLRESRAEAIERAEALLERVGLAAK-RNEYPAFLSGGQQQRVAIAR 571 Query: 186 ALAMEPEIILFDEPTSALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFL 245 ALAM P+++LFDEPTSALDPELVGEVL+VI++LAEEGRTM++VTHEM FAR VSS+V FL Sbjct: 572 ALAMRPKVMLFDEPTSALDPELVGEVLRVIRSLAEEGRTMILVTHEMAFARDVSSKVAFL 631 Query: 246 HQGRVEEHG--DARILDQPNSERLQQFLS 272 HQG +EE G DA +D P SER +QF++ Sbjct: 632 HQGMIEETGSPDAVFID-PRSERCRQFVN 659 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 664 Length adjustment: 32 Effective length of query: 244 Effective length of database: 632 Effective search space: 154208 Effective search space used: 154208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory