Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate GFF4363 PS417_22340 carbamate kinase
Query= uniprot:P13982 (310 letters) >FitnessBrowser__WCS417:GFF4363 Length = 309 Score = 514 bits (1323), Expect = e-150 Identities = 255/309 (82%), Positives = 282/309 (91%), Gaps = 1/309 (0%) Query: 1 MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQ 60 MRIVVALGGNALLRRGEPMTADNQR N+RIA EQIAK+ GNELVIAHGNGPQVGLL+LQ Sbjct: 1 MRIVVALGGNALLRRGEPMTADNQRANIRIATEQIAKIHAGNELVIAHGNGPQVGLLSLQ 60 Query: 61 GAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQNP 120 AAY +VSPYPLDVLGAETEGMIGY+IEQE+GNLL FEVPFAT+LTQVEVD KDPAFQNP Sbjct: 61 AAAYTQVSPYPLDVLGAETEGMIGYIIEQELGNLLDFEVPFATLLTQVEVDAKDPAFQNP 120 Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180 TKPIGPVYS+ EAE+LAAEKGW+IAPDGDK+RRVV SPRPKRIFEIRP+ WLL+KG+IVI Sbjct: 121 TKPIGPVYSKAEAEKLAAEKGWAIAPDGDKYRRVVASPRPKRIFEIRPITWLLDKGSIVI 180 Query: 181 CAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKPT 240 CAGGGGIPTMY E G KL G+EAVIDKDLCSSLLA +L AD+L+IATDV+AA++D+GKPT Sbjct: 181 CAGGGGIPTMYGEDG-KLRGIEAVIDKDLCSSLLASQLKADLLVIATDVNAAFIDFGKPT 239 Query: 241 QKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGTRV 300 QKAI QAHPDE+E+LGFAAGSMGPKVQAA EFAR TGK AVIGSL+DI AI +G AGTR+ Sbjct: 240 QKAIGQAHPDEMEKLGFAAGSMGPKVQAACEFARQTGKTAVIGSLSDIEAIVQGSAGTRI 299 Query: 301 STRKAGIEY 309 ST K GI Y Sbjct: 300 STAKPGITY 308 Lambda K H 0.317 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 309 Length adjustment: 27 Effective length of query: 283 Effective length of database: 282 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate GFF4363 PS417_22340 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.27944.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-133 429.5 0.1 3.6e-133 429.3 0.1 1.0 1 lcl|FitnessBrowser__WCS417:GFF4363 PS417_22340 carbamate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF4363 PS417_22340 carbamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 429.3 0.1 3.6e-133 3.6e-133 1 308 [. 1 300 [. 1 301 [. 0.98 Alignments for each domain: == domain 1 score: 429.3 bits; conditional E-value: 3.6e-133 TIGR00746 1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaadsvpakPldv 75 +++vvaLGGnall+rge ++a++qr n+++a++q++k+++ g+elvi+hGngPqvG l lq +a+ +v+++Pldv lcl|FitnessBrowser__WCS417:GFF4363 1 MRIVVALGGNALLRRGEPMTADNQRANIRIATEQIAKIHA-GNELVIAHGNGPQVGLLSLQAAAYTQVSPYPLDV 74 589************************************9.********************************** PP TIGR00746 76 lgaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigpfydeeeakrlaaekgailke 150 lgae++g+iGY+++q+l + l +e ++at+ltqv+vd+kD+aFqnPtkpigp+y+++ea++laaekg+ ++ lcl|FitnessBrowser__WCS417:GFF4363 75 LGAETEGMIGYIIEQELGNLLD---FEVPFATLLTQVEVDAKDPAFQNPTKPIGPVYSKAEAEKLAAEKGWAIAP 146 *********************9...************************************************** PP TIGR00746 151 dagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvk.dgkelkGveaviDkDlasekLaeevnaD 224 +g+++Rrvv+sP+Pk+i+e++ i +L++kg ivi++gGGG+P+++ ++ +l+G+eaviDkDl+s++La +++aD lcl|FitnessBrowser__WCS417:GFF4363 147 -DGDKYRRVVASPRPKRIFEIRPITWLLDKGSIVICAGGGGIPTMYgEDGKLRGIEAVIDKDLCSSLLASQLKAD 220 .99*****************************************9835567************************ PP TIGR00746 225 ilviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaaiefvesrgkkaiitslekiveal 299 lvi+tdv+a+++++gkp++k++ +++++e+e+l faaGsmgPkv+aa ef++++gk+a+i+sl++i++++ lcl|FitnessBrowser__WCS417:GFF4363 221 LLVIATDVNAAFIDFGKPTQKAIGQAHPDEMEKLG----FAAGSMGPKVQAACEFARQTGKTAVIGSLSDIEAIV 291 ***********************************....************************************ PP TIGR00746 300 egkaGtvvv 308 +g aGt+++ lcl|FitnessBrowser__WCS417:GFF4363 292 QGSAGTRIS 300 *******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.56 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory