Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate GFF2365 PS417_12060 sugar ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >FitnessBrowser__WCS417:GFF2365 Length = 325 Score = 147 bits (372), Expect = 3e-40 Identities = 102/334 (30%), Positives = 171/334 (51%), Gaps = 20/334 (5%) Query: 34 APSVEAPGLRTRLARNPEWFTVALIVVTCLIVGAINPRFFQ-FATLFDLLHSATTMSLFA 92 AP AP R RL + + F + L+ + +V A + +F + D+L + + A Sbjct: 8 APVTAAP--RNRLRLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILA 65 Query: 93 LGTLVVLASGGIDVSFTAIAALTMYGITKAVFAWWPDAPFALILVTGALGGVVLGMVNGL 152 +G V+ + GID+S +I A G+ A+ A A + G G +LG+VNG Sbjct: 66 VGMTYVILTKGIDLSVGSILAFA--GLCSAMVATQGYGLLAAVSA-GMFAGAMLGVVNGF 122 Query: 153 LVHRLKAPSLIVTIGTQYLYRGLLLTFIGTTFFMNIPHSMDRFGRIPLFFYHTADGLRAV 212 +V L P + T+G + RG+ + ++P + + A G+ + Sbjct: 123 MVANLSIPPFVATLGMLSIARGMTFILNDGSPITDLPDA------------YLALGIGKI 170 Query: 213 LPVSVLALVAA--AVVTWWLLNRTMMGRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGM 270 P+ V ++ A A++ W +L T GR VYA+GG+ A G +R + V+ +G+ Sbjct: 171 GPIGVPIIIFAVVALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGL 230 Query: 271 LAGIAGILHVSNNRLANPFDLVGSELDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIK 330 LAG+AG++ + A P V ELD IAAV++GG ++GGTG++VGTL G +L+ +I Sbjct: 231 LAGLAGVVLSARTTSALPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVIN 290 Query: 331 SVLILVGVPSTWQKVIIGAFILLAGTLFALQRKR 364 + L L+GV S +Q+V G I+ A + ++K+ Sbjct: 291 NGLNLLGVSSYYQQVAKGLIIVFAVLIDVWRKKK 324 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 325 Length adjustment: 29 Effective length of query: 335 Effective length of database: 296 Effective search space: 99160 Effective search space used: 99160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory