GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_01113 in Pseudomonas simiae WCS417

Align deoxynucleoside transporter, ATPase component (characterized)
to candidate GFF2673 PS417_13635 D-ribose transporter ATP-binding protein

Query= reanno::Burk376:H281DRAFT_01113
         (515 letters)



>lcl|FitnessBrowser__WCS417:GFF2673 PS417_13635 D-ribose transporter
           ATP-binding protein
          Length = 510

 Score =  344 bits (882), Expect = 5e-99
 Identities = 200/488 (40%), Positives = 289/488 (59%), Gaps = 14/488 (2%)

Query: 13  QPFLEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEG-Q 71
           +P LE+ G+ K F G+  L+ V L    G+I+ L+GENG GKSTL+KI+SGA   D G +
Sbjct: 4   EPLLEMQGISKTFNGLRVLKTVGLKVYPGEIHALMGENGAGKSTLMKILSGAYQADPGGE 63

Query: 72  LVIEGVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTFDRR 131
           + I G          A A GI  +YQ+LSL PN+SVAEN+ L  EL     R   T DR+
Sbjct: 64  IRIAGQLIPTFDPATAKALGIAVIYQELSLCPNLSVAENIYLGREL-----RRGWTIDRK 118

Query: 132 VLAATAARALEAVGLPGNSEFQ-STLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSL 190
            + A     L+ +G    +EF  +T +  L +A RQLV IARA+ + AK ++MDEPTT L
Sbjct: 119 GMEAGCIEVLQRLG----AEFTPATRVSSLSIAERQLVEIARALHAHAKILVMDEPTTPL 174

Query: 191 TQKEVDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFTKAQ 250
           + +E D L A++  LR+QG+ ++++SH++ E YA+   V VLRDG  + +      +   
Sbjct: 175 SSRETDRLFALIKQLRSQGLAIIYISHRMAEIYALSDRVSVLRDGHYIGELTRDALSAEA 234

Query: 251 ISELMTGRHLSNERYRESA--HAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDS 308
           + ++M GR LS    +E A  +  ++V+ VR      +    SF LH GE+LG+ GL+ +
Sbjct: 235 LVKMMVGRDLSGFYKKEHAAYNPGNVVMRVRDMADGKRVRHCSFDLHAGEVLGIAGLVGA 294

Query: 309 GRNELARALAGVAPAQSGDVLLDGQQIA-LRTPSDAKRHRIGYVPEDRLNEGLFLDKPIR 367
           GR ELAR +    P  SG + + G+ +  LRTP+DA R  + Y+ EDR  +GLFLD  + 
Sbjct: 295 GRTELARLIFAADPRTSGTLEVVGKAVTPLRTPADAIRAGVVYLTEDRKAQGLFLDMSVA 354

Query: 368 DNVITAMISSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGR 427
           DN+            G +DR  A   +   +K L I          +LSGGNQQ+VL+ R
Sbjct: 355 DNINVCACVPDAHAGGVLDRDHALQRSNDAIKSLSIRVASGKVNAGALSGGNQQKVLLAR 414

Query: 428 WLAIDPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMM 487
            L + P VLIL  PT GVD+GSK  IYRI+ +L+Q GIGI++IS +LPE++  CDR+L+M
Sbjct: 415 LLEVKPHVLILDEPTRGVDIGSKSEIYRIINQLAQAGIGIVVISSELPEIIGTCDRVLIM 474

Query: 488 KKGHVSAE 495
           ++G + AE
Sbjct: 475 REGQLVAE 482



 Score = 67.4 bits (163), Expect = 1e-15
 Identities = 59/222 (26%), Positives = 101/222 (45%), Gaps = 24/222 (10%)

Query: 290 VSFKLHGGEILGVTGLLDSGRNELARALAGVAPAQ-SGDVLLDGQQIALRTPSDAKRHRI 348
           V  K++ GEI  + G   +G++ L + L+G   A   G++ + GQ I    P+ AK   I
Sbjct: 25  VGLKVYPGEIHALMGENGAGKSTLMKILSGAYQADPGGEIRIAGQLIPTFDPATAKALGI 84

Query: 349 GYV-------PEDRLNEGLFLDKPIRDNVITAMISSLRDRFGQIDRTRAQALAEQTVKEL 401
             +       P   + E ++L + +R             R   IDR   +A   + ++ L
Sbjct: 85  AVIYQELSLCPNLSVAENIYLGRELR-------------RGWTIDRKGMEAGCIEVLQRL 131

Query: 402 QIA-TPGVDKPVQSLSGGNQQRVLIGRWLAIDPRVLILHGPTVGVDVGSKDIIYRIMQRL 460
               TP     V SLS   +Q V I R L    ++L++  PT  +     D ++ ++++L
Sbjct: 132 GAEFTPATR--VSSLSIAERQLVEIARALHAHAKILVMDEPTTPLSSRETDRLFALIKQL 189

Query: 461 SQRGIGIILISDDLPELLQNCDRILMMKKGHVSAEYRADELS 502
             +G+ II IS  + E+    DR+ +++ GH   E   D LS
Sbjct: 190 RSQGLAIIYISHRMAEIYALSDRVSVLRDGHYIGELTRDALS 231


Lambda     K      H
   0.319    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 646
Number of extensions: 32
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 515
Length of database: 510
Length adjustment: 35
Effective length of query: 480
Effective length of database: 475
Effective search space:   228000
Effective search space used:   228000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory