Align deoxynucleoside transporter, permease component 1 (characterized)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01115 (357 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 115 bits (288), Expect = 2e-30 Identities = 92/298 (30%), Positives = 155/298 (52%), Gaps = 12/298 (4%) Query: 24 VLVVLVATWLSRGQFVDIDNLQSMGGQLPELGLLALGIMLSMVSGNGGIDLSGVGLANLS 83 ++++LV L+ F+ + NL + Q +LA G+ +++ GIDLS + S Sbjct: 28 LILLLVGFALASENFLTMQNLSIISQQASVNVVLAAGMTFVILTA--GIDLSVGAILAAS 85 Query: 84 GMVAAMLVPRLVNGDDSPVLYTSLFCAIVLMMGLLGGLLNGVVIARLRLTPILCTLGTQL 143 +VA + SP + A + GLL GL+NG +IA +RL P + TLG Sbjct: 86 AVVA-------LQASMSPQ-FGMFGIAAGIGFGLLLGLVNGGLIAFMRLPPFIVTLGALT 137 Query: 144 LFTGFAVVISNGASVHVDYVEPLSDIGNGTVLQVPIAFCIFLAAVIVLGWLLKRSPFGLR 203 G A ++++ +V + P + IGN ++L VP I +A V + ++L+R+ G++ Sbjct: 138 AMRGLARLLADDKTVFNPDL-PFAFIGNDSLLGVPWLVIIAVAVVALSWFILRRTVMGVQ 196 Query: 204 LYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAGLISATHTSSAK-WDYGNSYLLIA 262 +Y +G NP+AA +GI ++L+ YAM G LA L ++SA+ +A G SY L A Sbjct: 197 IYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSASRLFAANGLQLGQSYELDA 256 Query: 263 ILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLLGVSQFFGDCAWGFLLLLSLA 320 I ++GG + GG G I A ++ L++ LLGVS + G +++ ++A Sbjct: 257 IAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVA 314 Lambda K H 0.327 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 325 Length adjustment: 28 Effective length of query: 329 Effective length of database: 297 Effective search space: 97713 Effective search space used: 97713 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory