GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Pseudomonas simiae WCS417

Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate GFF2332 PS417_11890 D-ribose transporter ATP-binding protein

Query= TCDB::A2RKA7
         (506 letters)



>lcl|FitnessBrowser__WCS417:GFF2332 PS417_11890 D-ribose transporter
           ATP-binding protein
          Length = 517

 Score =  302 bits (774), Expect = 2e-86
 Identities = 168/497 (33%), Positives = 284/497 (57%), Gaps = 8/497 (1%)

Query: 6   VIQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHV 65
           ++++++++K F   VA   V L ++ G + AL+GENGAGKSTLM I++G+ +P  GE+ +
Sbjct: 23  LLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGAGKSTLMKIIAGIYQPDAGEIRL 82

Query: 66  KGKLENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINL-DLKTAKKKIL 124
           +GK    ++P  A   GI M+HQ   L+   ++ ENI +G E    +++ + +   +   
Sbjct: 83  RGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIWIGREQLNSLHMVNHREMHRCTA 142

Query: 125 ELSERYGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQI 184
           EL  R  ++++P+  + ++S+ ++Q VEI K +   +DILI DEPT+ +T  E+  L  I
Sbjct: 143 ELLARLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSDILIMDEPTSAITEKEVAHLFSI 202

Query: 185 MKNLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVS 244
           + +L  +GK I+ ITHK++E+ A+AD + V R G  I         +  L  +MVGR +S
Sbjct: 203 IADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIGLQRADSMNSDSLISMMVGRELS 262

Query: 245 FITEKAAAQPKDVVLEIKDLNIKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTELVKA 304
            +         D++L ++DL +         K +S D+ AGEI+G+AG+ G+G+T + + 
Sbjct: 263 QLFPLRETPIGDLLLTVRDLTLDG-----VFKDVSFDLHAGEILGIAGLMGSGRTNVAET 317

Query: 305 ITGLTKVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQTYY 364
           I G+T   SG I L  K +    P    E+    + EDR   GL   ++V EN+ +    
Sbjct: 318 IFGITPSSSGQITLDGKAVRISDPHMAIEKGFALLTEDRKLSGLFPCLSVLENMEMAVL- 376

Query: 365 KPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDRNPDL 424
            P  +  GF+    + +   ++ ++  V+         +LSGGNQQKA++AR +  NP L
Sbjct: 377 -PHYTGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQQKALLARWLMTNPRL 435

Query: 425 LIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQIQGI 484
           LI+ +PTRG+DVGA   I++ +     EG AV++IS EL E+L +SDR+ V+H+G++ G 
Sbjct: 436 LILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLGMSDRVMVMHEGELMGT 495

Query: 485 VSPETTTKQELGILMVG 501
           +     T++++  L  G
Sbjct: 496 LDRSEATQEKVMQLASG 512



 Score = 90.1 bits (222), Expect = 2e-22
 Identities = 58/265 (21%), Positives = 136/265 (51%), Gaps = 12/265 (4%)

Query: 246 ITEKAAAQPKDV----VLEIKDLNIKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTEL 301
           +++  + QP+ +    +LEI +++ K   G + +  + L VR G ++ + G +G G++ L
Sbjct: 7   VSQPPSLQPQTLEEPYLLEIVNIS-KGFPGVVALADVQLRVRPGTVLALMGENGAGKSTL 65

Query: 302 VKAITGLTKVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIALQ 361
           +K I G+ + D+G I+L  K I  + P    +  +  + ++ +   L+  M++AENI + 
Sbjct: 66  MKIIAGIYQPDAGEIRLRGKPIVFETPLAAQKAGIAMIHQELN---LMPHMSIAENIWIG 122

Query: 362 TYYKPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDRN 421
              +  ++    +++ +++    EL+    +    E     +LS   +Q   IA+ +  +
Sbjct: 123 ---REQLNSLHMVNHREMHRCTAELLARLRINLDPE-EQVGNLSIAERQMVEIAKAVSYD 178

Query: 422 PDLLIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQI 481
            D+LI+ +PT  +    + ++   +   + +GK ++ I+ +++E+  ++D +AV  DG  
Sbjct: 179 SDILIMDEPTSAITEKEVAHLFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHY 238

Query: 482 QGIVSPETTTKQELGILMVGGNINE 506
            G+   ++     L  +MVG  +++
Sbjct: 239 IGLQRADSMNSDSLISMMVGRELSQ 263


Lambda     K      H
   0.315    0.135    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 586
Number of extensions: 26
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 506
Length of database: 517
Length adjustment: 35
Effective length of query: 471
Effective length of database: 482
Effective search space:   227022
Effective search space used:   227022
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory