GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Pseudomonas simiae WCS417

Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate GFF3463 PS417_17730 ribonucleotide-diphosphate reductase subunit alpha

Query= TCDB::A2RKA7
         (506 letters)



>lcl|FitnessBrowser__WCS417:GFF3463 PS417_17730
           ribonucleotide-diphosphate reductase subunit alpha
          Length = 502

 Score =  306 bits (783), Expect = 1e-87
 Identities = 176/504 (34%), Positives = 288/504 (57%), Gaps = 14/504 (2%)

Query: 5   TVIQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVH 64
           +++++ ++ KR+    A   +NL++++GEIHALLGENGAGKSTLM IL G+    EG++ 
Sbjct: 3   SLLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEGQIL 62

Query: 65  VKGKLENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKIL 124
           + G+ +   +   A   GIG+V Q F L+   T  ENI LG+E++    L     K++++
Sbjct: 63  IDGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGL---LRKREMV 119

Query: 125 ELSE----RYGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITE 180
           E SE    R G++++    ++ +SV +QQ VEI K L   A +L+ DEPTA LTP+E   
Sbjct: 120 EASEALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAEL 179

Query: 181 LMQIMKNLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVG 240
           L +IM+ L ++G ++I I+H L+EI  V DRI+V+R G ++   ++ D     L E+MVG
Sbjct: 180 LFEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDHLVEMMVG 239

Query: 241 RSVS-FITEKAAAQPKDVVLEIKDLNIKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQT 299
           R ++     K   +   ++LE+KD+ +  +    +       +  GEI+G AG+ G+G+T
Sbjct: 240 RRLACSFPPKPTRERGPLLLEVKDIQLVRNGPHNR-----FQLHKGEILGFAGLVGSGRT 294

Query: 300 ELVKAITGLTKVDSGSIKLHNKDITNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIA 359
           EL   + G     S  + L  + IT   P +     +G +PE R  +GL+ + ++ ENI+
Sbjct: 295 ELALGMMGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENIS 354

Query: 360 LQTYYKPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREID 419
           L    K   +  G +D N+  +    LM++  ++         +LSGGNQQK +IAR I+
Sbjct: 355 LNNLPK-YQNASGLIDKNRECASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWIN 413

Query: 420 RNPDLLIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDG 479
            + D+L+  +PTRG+DVGA   I+  +    ++G A+++IS EL EI+ + DR+AV H G
Sbjct: 414 HHCDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVAVFHKG 473

Query: 480 QIQGIVSPETTTKQELGILMVGGN 503
            I  ++       QE+     GG+
Sbjct: 474 AIVKLLEASAVNPQEVMRHATGGS 497



 Score = 89.0 bits (219), Expect = 4e-22
 Identities = 62/229 (27%), Positives = 118/229 (51%), Gaps = 13/229 (5%)

Query: 28  ELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHVKGKLENIDSPSKAANLGIGMVH 87
           +L KGEI    G  G+G++ L   + G L     +V ++G+   +D P++A   GIG++ 
Sbjct: 276 QLHKGEILGFAGLVGSGRTELALGMMGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLP 335

Query: 88  QHFM---LVDAFTVTENIILGN----EVTKGI---NLDLKTAKKKILELSERYGLSVEPD 137
           +      L+  F++ ENI L N    +   G+   N +  + +  + +LS +   S   +
Sbjct: 336 ESRKSEGLITDFSIRENISLNNLPKYQNASGLIDKNRECASVEGLMKQLSIKAPSS---E 392

Query: 138 ALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQIMKNLIKEGKSIIL 197
           + + ++S G QQ+V I + +    D+L+FDEPT  +      ++  +M++L ++G +II+
Sbjct: 393 SRVFNLSGGNQQKVVIARWINHHCDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAIIM 452

Query: 198 ITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVSFI 246
           I+ +L EI  + DR+ V  +G  +  +E      QE+     G S  ++
Sbjct: 453 ISSELPEIIGMCDRVAVFHKGAIVKLLEASAVNPQEVMRHATGGSSEYV 501


Lambda     K      H
   0.315    0.135    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 587
Number of extensions: 33
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 506
Length of database: 502
Length adjustment: 34
Effective length of query: 472
Effective length of database: 468
Effective search space:   220896
Effective search space used:   220896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory