GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adhBqn in Pseudomonas simiae WCS417

Align Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 (characterized)
to candidate GFF2133 PS417_10880 alcohol dehydrogenase

Query= SwissProt::P0A388
         (468 letters)



>lcl|FitnessBrowser__WCS417:GFF2133 PS417_10880 alcohol
           dehydrogenase
          Length = 447

 Score =  382 bits (982), Expect = e-110
 Identities = 195/405 (48%), Positives = 253/405 (62%), Gaps = 10/405 (2%)

Query: 29  DSALVQKGAYVARLGDCVACHTALHGQSYAGGLEIKSPIGTIYSTNITPDPTYGIGRYTF 88
           + ALV +G YVARL DCVACH+      +AGGLE+ +P+G I++TNITPD + GIG Y+ 
Sbjct: 46  EPALVSRGEYVARLSDCVACHSLAGKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSL 105

Query: 89  AEFDEAVRHGIRKDGSTLYPAMPYPSFSRMTKEDMQALYAYFMHGVKPVAQPDKQPDISW 148
           A+FD AVRHG+   G  LYPAMPYPS+ +++ +D++ALYA+FM G+KP  QP+   DI W
Sbjct: 106 ADFDRAVRHGVAPGGRRLYPAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPW 165

Query: 149 PLSMRWPLGIWRMMFSPSPKDFTPAPGTDPEIARGDYLVTGPGHCGACHTPRGFAMQEKA 208
           PL+MRWP+ +W  +F+P+   +   P  D    RG Y+V GPGHCG+CHTPRG A  EKA
Sbjct: 166 PLNMRWPIALWNGVFAPT-ATYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKA 224

Query: 209 LDAAGGPDFLSGGAPIDNWVAPSLRNDPVVGLGRWSEDDIYTFLKSGRIDHSAVFGGMGD 268
           LD AG P FL+ GA +D W APSLR DP  GLGRWSE  I  FLK+GR  H+ V+G M +
Sbjct: 225 LDEAGAP-FLA-GALLDGWYAPSLRQDPNTGLGRWSEPQIVQFLKTGRNAHAVVYGSMTE 282

Query: 269 VVAWSTQYFTDDDLHAIAKYLKSLPPVPPSQGNYTYDPSTANMLASGNTASVPGADTYVK 328
               STQ+  DDDL AIA+YLKSLP  P   G      +     A       PGA TY  
Sbjct: 283 AFNNSTQFMQDDDLAAIARYLKSLPGDPQRDG------APWQYQAVAAVQDAPGAHTYAT 336

Query: 329 ECAICHRNDGGGVARMFPPLAGNPVVVTENPTSLVNVIAHGGVLPPSNWAPSAVAMPGYS 388
            CA CH  DG G     PPLAG    + +   S +N+  +G     ++  P A  MP + 
Sbjct: 337 RCASCHGLDGKGQPEWMPPLAGATSALAKESASAINITLNGSQRVVASGVPDAYRMPAFR 396

Query: 389 KSLSAQQIADVVNFIRTSWGNKAPGTVTAADVTKLRDTGAPVSSS 433
           + LS  +IA+V++++R++WGN   G V A  V KLR    P SSS
Sbjct: 397 EQLSDTEIAEVLSYVRSTWGNNG-GAVDANAVGKLRGHTDPASSS 440



 Score = 32.0 bits (71), Expect = 4e-05
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 20/136 (14%)

Query: 23  AQTPDADSALVQKGAYVAR-LGDCVACHT---------ALH--GQSYAGGLEIKSPIGTI 70
           A  PD D AL  +GAY+ +  G C +CHT         AL   G  +  G    + +   
Sbjct: 187 AAKPDQD-ALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAG----ALLDGW 241

Query: 71  YSTNITPDPTYGIGRYTFAEFDEAVRHGIRKDGSTLYPAM--PYPSFSRMTKEDMQALYA 128
           Y+ ++  DP  G+GR++  +  + ++ G R   + +Y +M   + + ++  ++D  A  A
Sbjct: 242 YAPSLRQDPNTGLGRWSEPQIVQFLKTG-RNAHAVVYGSMTEAFNNSTQFMQDDDLAAIA 300

Query: 129 YFMHGVKPVAQPDKQP 144
            ++  +    Q D  P
Sbjct: 301 RYLKSLPGDPQRDGAP 316


Lambda     K      H
   0.317    0.134    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 705
Number of extensions: 37
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 468
Length of database: 447
Length adjustment: 33
Effective length of query: 435
Effective length of database: 414
Effective search space:   180090
Effective search space used:   180090
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory