Align ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale)
to candidate GFF3463 PS417_17730 ribonucleotide-diphosphate reductase subunit alpha
Query= uniprot:A0A0C4Y5F6 (540 letters) >FitnessBrowser__WCS417:GFF3463 Length = 502 Score = 354 bits (909), Expect = e-102 Identities = 217/513 (42%), Positives = 309/513 (60%), Gaps = 25/513 (4%) Query: 13 LLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAYTADPGGECH 72 LL L NICK +PGV+AL+ + L GE+HAL+GENGAGKSTLMKIL G D G + Sbjct: 4 LLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEG-QIL 62 Query: 73 IDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRR-GLVARGDMVRAC 131 IDGQ Q + A G+ +++QE SL P L+ ENI+LG L R GL+ + +MV A Sbjct: 63 IDGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGLLRKREMVEAS 122 Query: 132 APTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLSTHETDRLFA 191 RLG V LS+A++Q VEIA+A+ +AR+LV+DEPT L+ E + LF Sbjct: 123 EALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAELLFE 182 Query: 192 LIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALVKMMVGRDL 251 ++R+L+ +G+A+++ISH + EI ++ DR++VLRDG VG D A LV+MMVGR L Sbjct: 183 IMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDHLVEMMVGRRL 242 Query: 252 SGFY----TKTHGQAVEREVMLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGAGRTELA 307 + + T+ G ++L V+D+ R F L GE+LG AGLVG+GRTELA Sbjct: 243 ACSFPPKPTRERG-----PLLLEVKDIQLVRNGPHNRFQLHKGEILGFAGLVGSGRTELA 297 Query: 308 RLVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLDQSVH 367 + GA +V + G +TL P QA+ GI L E RK +GL D S+ Sbjct: 298 LGMMGALPSVSKDVWL-----RGEKITL--DDPAQALAHGIGLLPESRKSEGLITDFSIR 350 Query: 368 ENINL--IVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKVML 425 ENI+L + ++A GL NR A + L I+ ++ V LSGGNQQKV++ Sbjct: 351 ENISLNNLPKYQNASGLIDKNRECA--SVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVI 408 Query: 426 SRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDRVL 485 +R + VL+ DEPTRG+D+GAK++IY L+ +L + G AI+MISSELPE++G+CDRV Sbjct: 409 ARWINHHCDVLVFDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVA 468 Query: 486 VMREGTLAGEVRPAGSAAETQERIIALATGAAA 518 V +G + V+ ++A + ++ ATG ++ Sbjct: 469 VFHKGAI---VKLLEASAVNPQEVMRHATGGSS 498 Lambda K H 0.320 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 576 Number of extensions: 28 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 540 Length of database: 502 Length adjustment: 35 Effective length of query: 505 Effective length of database: 467 Effective search space: 235835 Effective search space used: 235835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory