Align Xylose ABC transporter, periplasmic xylose-binding protein XylF (characterized, see rationale)
to candidate GFF2675 PS417_13645 ABC transporter
Query= uniprot:A0A0C4Y591 (325 letters) >FitnessBrowser__WCS417:GFF2675 Length = 310 Score = 382 bits (982), Expect = e-111 Identities = 191/295 (64%), Positives = 232/295 (78%) Query: 29 AAPASAAAQRPLKKVGVTLGSLGNPYFVALAHGAEAAAKKINPDAKVTVLSADYDLNKQF 88 A + A R LK +G+++GSLGNPYFV LA GA A AK++NP+ KVT +SADYDL+KQF Sbjct: 14 ALMSQAVEARELKALGISMGSLGNPYFVTLADGATARAKELNPNVKVTSVSADYDLSKQF 73 Query: 89 SHIDSFIVSKVDLILINAADARAIEPAVRKARKAGIVVVAVDVAAAGADATVQTDNTRAG 148 S ID+FI SKVDLILINA D A+ A++KAR AGIVVVAVDV A G +ATVQTDN AG Sbjct: 74 SQIDNFISSKVDLILINAVDPSAMASAIKKARDAGIVVVAVDVDAKGVNATVQTDNVEAG 133 Query: 149 ELACAFLAGRLGGRGNLIIQNGPPVSAVLDRVKGCKMVLGKHPGIHVLSDDQDGKGSREG 208 +LAC +L +L G+GN+IIQNGP V+AV DRVKGCK L P I VLSDDQDGKGSREG Sbjct: 134 KLACQYLVDKLSGKGNVIIQNGPQVTAVTDRVKGCKAALAAAPDIKVLSDDQDGKGSREG 193 Query: 209 GLNVMQLYLTRFPKIDAVFTINDPQAVGADLAARQLNRGGILIASVDGAPDIEAALKANT 268 GLNVMQ YLTRFPKID +F INDPQAVG+DLAA+QL R G++I SVDGAPDIE ALK ++ Sbjct: 194 GLNVMQGYLTRFPKIDGLFAINDPQAVGSDLAAKQLKRSGLIITSVDGAPDIENALKTDS 253 Query: 269 LVQASASQDPWAIARTAVEIGVGLMHGQAPANRTVLLPPTLVTRANVNEYKGWAA 323 +QAS+SQDPWA+A+TAV +G +++ +APA LL P L+TR N+ Y GW++ Sbjct: 254 QIQASSSQDPWAMAQTAVNVGNDILNDKAPAEAVTLLTPKLITRDNIGTYSGWSS 308 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 310 Length adjustment: 27 Effective length of query: 298 Effective length of database: 283 Effective search space: 84334 Effective search space used: 84334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory