Align Xylose ABC transporter, periplasmic xylose-binding protein XylF (characterized, see rationale)
to candidate GFF3464 PS417_17735 LacI family transcriptional regulator
Query= uniprot:A0A0C4Y591 (325 letters) >FitnessBrowser__WCS417:GFF3464 Length = 307 Score = 165 bits (417), Expect = 2e-45 Identities = 108/305 (35%), Positives = 175/305 (57%), Gaps = 10/305 (3%) Query: 17 LCTGAAAQSAPDAAPASAAAQRPLKKVGVTLGSLGNPYFVALAHGAEAAAKKINPDAKVT 76 LC A + + AAPA A A +P++ +G + + NPYFV + + E A I AK+ Sbjct: 8 LCLLAVSITLGTAAPAFADAAKPIR-IGASFQEINNPYFVTMKNALEEAGATIG--AKLI 64 Query: 77 VLSADYDLNKQFSHIDSFIVSKVDLILINAADARAIEPAVRKARKAGIVVVAVDVAAAGA 136 + A +D++KQ S ++ + +D++LIN D+ ++ AV+ A AG+VVVAVD A G Sbjct: 65 ITDARHDVSKQVSDVEDMLQKGIDILLINPTDSVGVQSAVKSAHAAGVVVVAVDAQADGP 124 Query: 137 -DATVQTDNTRAGELACAFLAGRLGGRGNLIIQNGPPVSAVLDRVKGCKMVLGKHPGIHV 195 D+ V + N AG AC +LA +G +GN+ I +G V +L+RV+GCK + KHP I + Sbjct: 125 LDSFVGSKNFDAGFQACEYLAKNIGDKGNIAILDGIAVVPILERVRGCKEAVAKHPDIKI 184 Query: 196 LSDDQDGKGSREGGLNVMQLYLTRFPKIDAVFTINDPQAVGADLAARQLNRGGILIASVD 255 +S Q+GK R+ L V + L P + +F++ND ++GA L+A + + + + SVD Sbjct: 185 VS-IQNGKQERDQALTVTENMLQAQPTLKGIFSVNDNGSLGA-LSAIEASGLDVKLVSVD 242 Query: 256 GAPD-IEAALKANTLVQASASQDPWAIARTAVEIGVGLMHG-QAPANRTVLLPPTLVTRA 313 GAP+ I+A K + A+++Q P R A+ I + G Q PA T+ + TL+ +A Sbjct: 243 GAPEAIKAIQKPGSKFIATSAQYPRDQIRLALGIALARKWGAQVPA--TLPVDITLIDQA 300 Query: 314 NVNEY 318 ++ Sbjct: 301 KAKDF 305 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 307 Length adjustment: 27 Effective length of query: 298 Effective length of database: 280 Effective search space: 83440 Effective search space used: 83440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory