Align Fructose import permease protein FruF (characterized)
to candidate GFF2365 PS417_12060 sugar ABC transporter permease
Query= SwissProt::Q8G846 (356 letters) >FitnessBrowser__WCS417:GFF2365 Length = 325 Score = 147 bits (370), Expect = 5e-40 Identities = 99/316 (31%), Positives = 167/316 (52%), Gaps = 28/316 (8%) Query: 26 VAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGMTLVISTAGID 85 + FILL ++ F+ +W + + +L++++ ++A GMT VI T GID Sbjct: 29 LVFILLCVVMAFSSEYFM--TWRN--------WMDILRQTSINGILAVGMTYVILTKGID 78 Query: 86 LSVGSVMAVAGAAAMQTLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFITTLIM 145 LSVGS++A AG + + G + ++ + G +G VNG +V+ L + PF+ TL M Sbjct: 79 LSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGM 138 Query: 146 MLAGRGMAKVITSGEN-TDASAVAGNEPLKWFANGF----ILGIPANFVIAVIIVILVGL 200 + RGM ++ G TD P + A G +G+P +I ++ ++ + Sbjct: 139 LSIARGMTFILNDGSPITDL-------PDAYLALGIGKIGPIGVP--IIIFAVVALIFWM 189 Query: 201 LCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGLFATASVMRVDVV 260 + R T G + AVG N++++R +GI +K++F VY +SG LA +AG+ +A + Sbjct: 190 VLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSA-LP 248 Query: 261 KTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLGVNA---EATPA 317 + G E+ AI AVVIGGTSL GG S+ G+ GA++I +I + LGV++ + Sbjct: 249 QAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKG 308 Query: 318 FFAVVVIVICVMQAPK 333 V ++I V + K Sbjct: 309 LIIVFAVLIDVWRKKK 324 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 325 Length adjustment: 28 Effective length of query: 328 Effective length of database: 297 Effective search space: 97416 Effective search space used: 97416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory