GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruF in Pseudomonas simiae WCS417

Align Fructose import permease protein FruF (characterized)
to candidate GFF2365 PS417_12060 sugar ABC transporter permease

Query= SwissProt::Q8G846
         (356 letters)



>lcl|FitnessBrowser__WCS417:GFF2365 PS417_12060 sugar ABC
           transporter permease
          Length = 325

 Score =  147 bits (370), Expect = 5e-40
 Identities = 99/316 (31%), Positives = 167/316 (52%), Gaps = 28/316 (8%)

Query: 26  VAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGMTLVISTAGID 85
           + FILL ++       F+  +W +         + +L++++   ++A GMT VI T GID
Sbjct: 29  LVFILLCVVMAFSSEYFM--TWRN--------WMDILRQTSINGILAVGMTYVILTKGID 78

Query: 86  LSVGSVMAVAGAAAMQTLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFITTLIM 145
           LSVGS++A AG  +    + G  +  ++   +  G  +G VNG +V+ L + PF+ TL M
Sbjct: 79  LSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGM 138

Query: 146 MLAGRGMAKVITSGEN-TDASAVAGNEPLKWFANGF----ILGIPANFVIAVIIVILVGL 200
           +   RGM  ++  G   TD        P  + A G      +G+P   +I  ++ ++  +
Sbjct: 139 LSIARGMTFILNDGSPITDL-------PDAYLALGIGKIGPIGVP--IIIFAVVALIFWM 189

Query: 201 LCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGLFATASVMRVDVV 260
           + R T  G  + AVG N++++R +GI  +K++F VY +SG LA +AG+  +A      + 
Sbjct: 190 VLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSA-LP 248

Query: 261 KTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLGVNA---EATPA 317
           + G   E+ AI AVVIGGTSL GG  S+ G+  GA++I +I   +  LGV++   +    
Sbjct: 249 QAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKG 308

Query: 318 FFAVVVIVICVMQAPK 333
              V  ++I V +  K
Sbjct: 309 LIIVFAVLIDVWRKKK 324


Lambda     K      H
   0.325    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 314
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 356
Length of database: 325
Length adjustment: 28
Effective length of query: 328
Effective length of database: 297
Effective search space:    97416
Effective search space used:    97416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory