Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 226 bits (576), Expect = 6e-64 Identities = 137/306 (44%), Positives = 197/306 (64%), Gaps = 18/306 (5%) Query: 43 LLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAV 102 L+L+++ F+ AS NF+ + NL I Q +VN VLA T+VI+T+GIDLSVG ++ AV Sbjct: 28 LILLLVGFALASENFLTMQNLSIISQQASVNVVLAAGMTFVILTAGIDLSVGAILAASAV 87 Query: 103 MA--GVVLTNWGMPLPLGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSL 160 +A + +GM GIAA I FG L G ++G +IA +++PPFI TLG + ++GL+ Sbjct: 88 VALQASMSPQFGM---FGIAAGIGFGLLLGLVNGGLIAFMRLPPFIVTLGALTAMRGLAR 144 Query: 161 VISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRY 220 +++ + + FN F+ I DSL+G +P V+I V + IL +TV G Sbjct: 145 LLADDKTV-FNPDLPFAFIGNDSLLG-------VPWLVIIAVAVVALSWFILRRTVMGVQ 196 Query: 221 TFALGSNEEALRLSGVKVDFWKVA--VYTFSGAICGIAGLIIASRLNSAQPA-LGQGYEL 277 +++G N EA RLSG+KV WKV VY SGA+ G+ ++ ASRL +A LGQ YEL Sbjct: 197 IYSVGGNPEAARLSGIKV--WKVLLFVYAMSGALAGLGAVMSASRLFAANGLQLGQSYEL 254 Query: 278 DAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVY 337 DAIAAV++GGTS +GG GTI GT+IGA I++VL NGL ++ V+ WQ ++ G++II AV Sbjct: 255 DAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVA 314 Query: 338 LDILRR 343 LD R+ Sbjct: 315 LDRYRQ 320 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 325 Length adjustment: 28 Effective length of query: 319 Effective length of database: 297 Effective search space: 94743 Effective search space used: 94743 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory