GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aldA in Pseudomonas simiae WCS417

Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate GFF4851 PS417_24810 aldehyde dehydrogenase

Query= metacyc::MONOMER-16244
         (495 letters)



>lcl|FitnessBrowser__WCS417:GFF4851 PS417_24810 aldehyde
           dehydrogenase
          Length = 506

 Score =  357 bits (915), Expect = e-103
 Identities = 208/483 (43%), Positives = 284/483 (58%), Gaps = 15/483 (3%)

Query: 16  TYEQPTGLFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSW 75
           +++   G +I  EFV       F   SP   + I +   + ++DID A++AA AA   +W
Sbjct: 14  SFKAKYGNYIGGEFVAPVDGNYFTNTSPVNGKAIAEFPRSTAKDIDKALDAAHAAA-DAW 72

Query: 76  STSDPQVRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCS-KGDVALTAAYFRSCAGWT 134
             +  Q R  VL K+AD I+++ + LA  E  DNGK++  +   D+ L A +FR  AG  
Sbjct: 73  GKTSAQDRALVLLKIADRIEQNLELLAITETWDNGKAVRETLNADIPLAADHFRYFAGCI 132

Query: 135 DKIKGSVIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAES 194
              +G+  E  +   +Y   EP+GV GQIIPWNFPLLMA+WKL P L  G   VLK AE 
Sbjct: 133 RAQEGTSAEINEHTASYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQ 192

Query: 195 TPLSALYLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKA 254
           TPL    L  LI +   PPGV+NVV G+G  AG  +++  +I K+AFTGST  G HIMK 
Sbjct: 193 TPLGINVLMELIGDL-LPPGVLNVVHGYGKEAGEALATSKRIAKIAFTGSTPVGSHIMKC 251

Query: 255 AAESNLKKVTLELGGKSPNIVFDDA--DVKSTIQHLVTGI---FYNTGEVCCAGSRIYVQ 309
           AAE N+   T+ELGGKSPNI F D      S I+    G+   F+N GEVC   SR  V+
Sbjct: 252 AAE-NIIPSTVELGGKSPNIFFADIMKAEPSFIEKAAEGLVLAFFNQGEVCTCPSRALVE 310

Query: 310 EGIYDKIVSEFKNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGG 369
           E IYD  +       E +K GDP   DT +GAQ S+ Q DKIL Y++I K EGA ++TGG
Sbjct: 311 ESIYDDFMKVVMKKVEQIKRGDPLDTDTMVGAQASEQQFDKILSYLEIAKGEGAQLLTGG 370

Query: 370 --ERFGNK---GYFIKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYG 424
             E+       GY+I+PT+     E  ++ ++EIFGPVV+IT FK   E +A+AND+E+G
Sbjct: 371 KVEQLSGDMAGGYYIQPTLLKGTNE-MRVFQEEIFGPVVSITTFKDEAEALAIANDTEFG 429

Query: 425 LAAGVHTTNLSTAISVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYT 484
           L AGV T +++ A  +   I +G +W N Y+ +     FGGY +SG+GRE  +  LD+Y 
Sbjct: 430 LGAGVWTRDINRAYRMGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHYQ 489

Query: 485 QVK 487
           Q K
Sbjct: 490 QTK 492


Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 631
Number of extensions: 27
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 506
Length adjustment: 34
Effective length of query: 461
Effective length of database: 472
Effective search space:   217592
Effective search space used:   217592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory