Align L-fucose dehydrogenase (EC 1.1.1.122) (characterized)
to candidate GFF2315 PS417_11805 D-threo-aldose 1-dehydrogenase
Query= reanno::BFirm:BPHYT_RS34225 (346 letters) >FitnessBrowser__WCS417:GFF2315 Length = 334 Score = 245 bits (626), Expect = 1e-69 Identities = 146/328 (44%), Positives = 194/328 (59%), Gaps = 13/328 (3%) Query: 25 LGLGTAPLGGLYRDLSDEEAHATIAAAWDAGVRYFDTAPHYGNTKAEHRLGDALRRYPRA 84 LG GTAPLG ++R + ++EA AT+ AAW+AGVRYFDTAP YG+ +E RLG AL +Y R Sbjct: 11 LGFGTAPLGNMFRAIPEDEAQATVEAAWNAGVRYFDTAPFYGSGLSEIRLGHALSQYNRD 70 Query: 85 DYVLSTKVGRRFVPR----TTPFDDKEG-WQNPLPFEAIYDYTHDGILRSFEDSQQRLGI 139 D+VLSTKVGR + +K G +++ P + + DY+ D LRS EDS RL Sbjct: 71 DFVLSTKVGRVILDEIEDSARDLGEKSGVFEHGRPNKMLNDYSADATLRSIEDSLTRLNT 130 Query: 140 VDIDILLVHDIGRVTHGDNHPHYWRQLTEGGGFRALDALRSSGAIKAVGLGVN--EGAAI 197 +DI+ +HDI + +GD Y+ Q G F+ L LR G IKA GLGVN E + Sbjct: 131 DRLDIVWIHDIAQDFYGDQWLEYFNQ-ARTGAFKVLTRLREEGVIKAWGLGVNRVEPCEL 189 Query: 198 LDAMAEFDIDCALLAGRYTLLE-QTTLDDLLPACEKRGVSILLGGAFNSGILARGVQGDL 256 + E D LLAGRYTLL+ L L+ A + V I++GG ++SGILA G Sbjct: 190 TLDLTEAQPDGFLLAGRYTLLDHDRALQRLMDAALAQNVEIVVGGPYSSGILAGGAH--- 246 Query: 257 KFNYGEAPPEVIERVARLEAVCRTHGVPLAAAALQFPYAHPTVATVLTGARSADELRENA 316 F Y +A P +I +V ++ A+ + GV + AAALQF AHP VA V+ GA + E+ Sbjct: 247 -FEYQQASPAIIRKVEQIRAIAQAFGVSVKAAALQFSLAHPAVAAVIPGASRPGRIAEDV 305 Query: 317 ASFELPIPAALWFALREEGLLDSRAPAP 344 A+ IPAA W ALRE L+ RAP P Sbjct: 306 AALSETIPAAFWQALREARLISDRAPLP 333 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 334 Length adjustment: 28 Effective length of query: 318 Effective length of database: 306 Effective search space: 97308 Effective search space used: 97308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory