Align Short-chain alcohol dehydrogenase protein (characterized, see rationale)
to candidate GFF1039 PS417_05265 short-chain dehydrogenase
Query= uniprot:D8IS13 (254 letters) >FitnessBrowser__WCS417:GFF1039 Length = 253 Score = 133 bits (335), Expect = 3e-36 Identities = 95/255 (37%), Positives = 135/255 (52%), Gaps = 20/255 (7%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIATDI-SKPHLDE----LAGIAGVETHLL- 61 ++ K LIT AA GIG+A +AR G V+ + PH + L AG E +L Sbjct: 1 MSRKVALITGAASGIGQALAVAYARNGVAVVGGYYPADPHDPQTTVSLVEEAGGECLMLP 60 Query: 62 -DVTDDAAIKALVAK----IGTIDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHT 116 DV D A++ AL A+ G +D AG + +LE D WD N++ + T Sbjct: 61 LDVGDTASVDALAAQTIQHFGRLDYAVANAGLLRRAPLLEMTDALWDEMLNVDLTGVMRT 120 Query: 117 IRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVAQGIRC 176 RA M ++ G++V I+S A V G Y A+KA V GL +S+A + A+GIRC Sbjct: 121 FRAATRHM--QEGGALVAISSIAGGVYGWQEHSHYAAAKAGVPGLCRSLAVELAAKGIRC 178 Query: 177 NAICPGTIESPSLNQRISTQAKETGKSEEEVRAAFVGRQPMGRIGKAEEVAALALYLASD 236 NA+ PG IE+P S AK + E +AA P+GR+G+A+EVA+L +L SD Sbjct: 179 NAVIPGLIETPQ-----SLDAKNSLGPEGLAKAA--RAIPLGRVGRADEVASLVQFLTSD 231 Query: 237 ESNFTTGSIHMIDGG 251 S++ TG +IDGG Sbjct: 232 ASSYLTGQSIVIDGG 246 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory