Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate GFF4166 PS417_21340 short-chain dehydrogenase
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__WCS417:GFF4166 Length = 273 Score = 140 bits (354), Expect = 2e-38 Identities = 97/268 (36%), Positives = 142/268 (52%), Gaps = 20/268 (7%) Query: 47 VSIPTTPNT----RLQGKRCLITAAGAGIGRESALACARAG-AHVIATDIDAAALQALAA 101 +S+P P RL GK +IT A GIG E+ +AC +A A +I DI ++ +AA Sbjct: 6 LSLPAVPEPTYGERLNGKVVIITGAAQGIG-EAIVACFQAQQARLIIADIQGEKVEKVAA 64 Query: 102 E----SDAITTQLLDVTDA----AAITALVAAHGPFDVLFNCAGYVHQGSILDCDEPAWR 153 I Q +D+T A + + G DVL NCAG L+ + WR Sbjct: 65 HWRERGADIYAQAVDITSKDQWQALVNLAIERFGRVDVLVNCAGVNVFRDPLEMTDEDWR 124 Query: 154 RSFSINVDAMYYTCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSK 213 R F+I++D ++ C+AVLP M+E+G G+IIN++S SS +P F Y V K ++GL++ Sbjct: 125 RCFAIDLDGAWFGCRAVLPHMIEQGIGNIINIASTHSS-HIIPGCFPYPVAKHGLLGLTR 183 Query: 214 AIAADYVAQGVRCNAICPGTIKTPSLGQRVQALGG--DEQAVWKSFTDRQPMGRLGDPRE 271 A+ +Y +G+R NAI PG I+T V G D A + D P R+G P E Sbjct: 184 ALGIEYAPKGIRVNAIAPGYIETQ---LNVDYWNGFPDPHAERQRAFDLHPPKRIGQPIE 240 Query: 272 IAQLVVYLASDESSFTTGQTHIIDGGWS 299 +A ++LA+DE+ F +IDGG S Sbjct: 241 VAMTALFLATDEAPFINATCLMIDGGRS 268 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 273 Length adjustment: 26 Effective length of query: 274 Effective length of database: 247 Effective search space: 67678 Effective search space used: 67678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory